KEGG   Pteropus alecto (black flying fox): 102895109Help
Entry
102895109         CDS       T02993                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102895109 (TMPRSS9)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102895109 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a DUF4951
Motif
Other DBs
NCBI-GeneID: 102895109
NCBI-ProteinID: XP_015456178
LinkDB All DBs
Position
Un
AA seq 1006 aa AA seqDB search
MEPTVGESQLVPRAAKDVPTRDAVCCRVALCAAVAASIVIVTLAVLVASLSIQGVDVEHT
AELRGIRYSRSLQQEASDYYRMLTPTLEMLLHFLLLALRSLDLGLERELLQQGLRARLQG
HGIPLAAHGTLVSAMLTGNQRGPLTERDLKSGRCPESAFSCGNGQCVTTVNPECDDKVDC
SDGSDEARCDCGSRPGWRTAGRIVGGVAASLGEFPWQVSLRENGEHFCGAAVLGPGWLVS
AAHLVKPEMLQKATVELLDQALCASLYGHSLTDRMMCAGYLGGKVDSCQGDSGGPLVCEE
PSGRFFLAGIVSWGIGCAEARRPGVYARVTKLRDWILEAIATASKPLSPTVVPGPATPST
AGPTSPESQVVGTPTQASLAPSSAPVDSATTSKPPECGARPALEKPARIVGGFGAAAGEV
PWQASLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTVSLSGVGGSPVKMGL
KRAVLHPQYNAGILDFDAAVLELARPLVFGKYVQPICLPLATQKFPAGRKCMISGWGSTQ
EGNATKPDALQRASVGIIDQKACSALYNFSLTDRMLCAGFLEGQVDSCQGDSGGPLACEE
TPGVFYLAGIVSWGIGCAQAKRPGVYVRIARLKGWILDTMSSHPLPTPVPSTTRTPATTS
HATSTTAGLTIPGVSASRPALWATSRATSPPATRPATAMSTTARGQTPPPKSPWTTMGSQ
PPDVALSSPGGPPPQQVGTAIPLPDVLTVILHVCVLVSPEKAPVVLGQGPAHAAGGGEWP
WQVSLWLQRREHRCGAVLVAEKWLLSAAHCFDVYGDPKQWAAFLGTPFLSGADGRLERVA
RIYKHPFYNLYTLDYDVALLELATPVRRSRLVRPICLPDPAPRPRDGTRCVITGWGSVRE
GGRRRPAPSGVRGLRSRVVRLLGEQACRRYYPVQISSRMLCAGSPHGGVDSCSGDAGGPL
ACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacggttggtgaatcacagctcgtaccccgggcagcaaaggacgtgcccact
cgggacgccgtgtgctgccgtgtcgccctctgtgctgcggtggccgccagcatcgtcatc
gtcacactggcggtccttgtggcctccctctccatacagggcgtcgatgtggagcacacg
gctgagctgcgggggatccggtactcccgcagcctgcagcaggaagcctcggactactac
cgcatgctgacacccaccctagagatgctgctacacttcctgctgttggccctgcggtcg
ctggacctgggcctggagcgggagcttctgcagcaggggctccgagcgaggctgcaaggc
cacggcatccccctggccgcccacggcacccttgtgtctgccatgctcacaggcaaccag
agggggccattgacagaacgggacttgaaatcaggtcgctgtccagaaagcgccttctcc
tgcgggaatggccagtgtgtgaccacggtgaacccggagtgtgatgacaaggtggactgc
tccgacggctccgacgaggcccgctgtgactgcggttcccggcccggctggaggacggcg
ggcaggatcgtgggtggcgtggcagcatctctcggcgagttcccttggcaagtcagcctc
cgggaaaacggcgagcacttctgcggggcggcggtgctggggcccggctggctggtgtcc
gccgcccacttggtcaagccagagatgctgcagaaggccactgtggagctgctggaccag
gcgctgtgcgccagcctgtacggccactcgctcacggaccggatgatgtgtgccggctac
ctgggcggcaaggtggattcctgccagggtgactcgggaggccccctggtctgcgaggag
ccgtcgggcaggtttttcctggccggcatcgtcagctggggcattggctgtgcggaagcc
cggcggccgggggtctacgcccgggtgaccaagttgcgggactggatcctcgaggcaatc
gccacggcaagcaagcctctgtcccccacggtggtgcctggccccgccacccccagcacc
gccgggcccaccagccctgagagccaggtggtgggcacccccacccaagcctcgctggcc
cccagctccgcacctgttgattcagcgaccacctctaagccgccagagtgcggggccagg
ccggcactggagaagcccgcccgcatcgtgggcgggttcggggcggctgcgggggaggtg
ccctggcaggccagcctgaaggaaggctcgcggcacttctgcggggccaccgtggtgggg
gaccgctggctgctctcggctgcccactgcttcaaccacacgaaggtggagctggtgcgg
gcccacctgggcaccgtgtccctctcgggcgttggcgggagcccggtgaaaatggggctc
aagcgggcagtgctgcacccccagtacaatgccggcatcctggacttcgacgcggctgtc
ctggagctggcccggcccctggtcttcggcaagtatgtccagcccatctgcctgcccttg
gccacccagaagttccccgcgggccgcaagtgcatgatctccgggtggggcagcacgcag
gagggaaacgcgacgaagccagacgctctccagcgggcgtctgtgggcatcatagaccag
aaggcatgcagcgccctctacaacttctccctcacggaccggatgctctgcgccggcttc
ttggagggccaggtggactcctgccagggcgattccgggggaccgctggcctgcgaggag
acccctggtgtgttttacctggcggggatcgtcagctgggggatcggctgtgctcaggcc
aagagacccggcgtgtacgttcgaatcgccaggctgaagggctggatcctggacaccatg
tcctcccaccccctccccacacctgtcccgtccaccacgaggacacctgccaccaccagc
catgccaccagcacgacagctggcctcacaatcccgggggtctcggccagcaggcccgcc
ctctgggccaccagcagagcaacgagtccacctgccaccaggcctgccaccgccatgagc
accactgctagggggcagacgccacctccaaagtccccgtggaccaccatgggctcccag
ccaccagacgtggctctctccagccccggaggcccccctcctcagcaagtgggcactgcc
atccctctccccgatgtcctcacggtcatcctccacgtctgtgtcctcgtctctcctgag
aaggcccccgtcgtgttgggccagggtccagcccacgccgcggggggcggggagtggccg
tggcaggtgagcctgtggctgcagcgccgggagcaccgctgcggggccgtgctggtggcc
gagaagtggctgctgtctgcggcgcactgcttcgacgtctacggggaccccaagcagtgg
gcggccttcctgggtacgccgttcctgagcggcgccgacgggcggctggagcgcgtggcg
cgcatctacaagcaccccttctacaacctctacacgctcgactacgacgtggcgctgctc
gagctggcgacgcccgtgcgccgcagccgcttagtgcggcccatctgcctgcccgacccc
gcacccaggcctcgcgacggcacgcgctgcgtcatcaccggctggggctcggtgcgcgag
ggaggtaggcggcggcccgcaccctcaggagtgaggggtctgcggagtcgggtggtccgc
ctcctgggcgagcaggcctgccgccgctactacccggtgcagatcagcagccgcatgctg
tgcgccggctccccgcacggcggcgtggacagctgctcgggtgacgccgggggacccctg
gcatgccgggagccatctggtcggtgggtgctaaccggggtcaccagctggggctacggc
tgcgggcggccccacttcccgggcgtctacacccgggtggcagctgtgagaggttggatc
gggcagaacatccaggagtga

DBGET integrated database retrieval system