KEGG   Psychrobacter alimentarius: A3K91_2269Help
Entry
A3K91_2269        CDS       T04320                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00020  Citrate cycle (TCA cycle)
pali00270  Cysteine and methionine metabolism
pali00620  Pyruvate metabolism
pali00630  Glyoxylate and dicarboxylate metabolism
pali00680  Methane metabolism
pali01100  Metabolic pathways
pali01110  Biosynthesis of secondary metabolites
pali01120  Microbial metabolism in diverse environments
pali01130  Biosynthesis of antibiotics
pali01200  Carbon metabolism
Module
pali_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pali_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pali_M00012  Glyoxylate cycle
pali_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pali00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3K91_2269
   00620 Pyruvate metabolism
    A3K91_2269
   00630 Glyoxylate and dicarboxylate metabolism
    A3K91_2269
  Energy metabolism
   00680 Methane metabolism
    A3K91_2269
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A3K91_2269
Enzymes [BR:pali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     A3K91_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AMT97848
UniProt: A0A144Q1C8
LinkDB All DBs
Position
complement(2762246..2763235)
Genome map
AA seq 329 aa AA seqDB search
MSMKQPLRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEITPALDALKGVVMELE
DCAFPLLAGVVQTDDATVAFKDIDYALLVGARPRGPGMERKDLLEANAAIFSAQGKALND
VASRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAEKTESTVNDV
KNMTIWGNHSSTQYPDLTACTVNGKPALDLVDRDWYENTYIPDVQQRGAAIIKARGASSA
ASAANAAIAHMRTWALGTDENDWVSMGVYSNGEYGIAEGLIYSFPCTCSNGDWSIVDGVD
VSSDFSKEKMKATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctttacgtgttgccgtcactggtgccgctggtaatatcagctac
gcgatgctatttcgtattgcatctggcgagatgctaggtaaagatcagccagttattttg
caattgcttgaaatcacaccagctcttgacgccctaaagggtgtagttatggaattggaa
gattgtgctttcccattgttggcaggcgttgttcaaacggatgatgcgactgttgcattc
aaagatatcgattatgcattactggttggcgcacgtcctcgtggcccaggtatggaacgt
aaagatttgctagaagccaacgctgcgattttctcagcacaaggtaaagcattgaatgac
gttgcaagccgcgacgtaaaagtattggttgtgggtaaccctgccaacactaacgcactg
atcgctcagcgtaatgcaccagatcttgatccacgtaacttcacggcaatgacgcgtttg
gatcataatcgtgcgatggctcagttggctgaaaaaactgaaagcactgtcaacgacgtt
aaaaacatgacaatctggggcaaccattcctctactcagtatccagacctaacagcttgt
actgttaacggtaagccagcgctagatttggttgatcgtgactggtacgaaaacacttat
atcccagacgtacaacagcgtggtgcagcaatcattaaagctcgtggtgcttcgtctgcc
gcttctgctgccaacgctgctatcgcacacatgcgtacgtgggcactaggtaccgatgaa
aacgattgggtgtctatgggtgtttactcaaacggcgaatatggtattgcggaaggcctc
atttactcattcccttgcacctgtagcaatggcgattggtctatcgtagacggcgttgat
gtgtcatcagatttctcaaaagagaaaatgaaagccactgagcaagagcttagtgaagag
cgtgatgcagtagcgcatctacttccataa

DBGET integrated database retrieval system