KEGG   Psychrobacter alimentarius: A3K91_2479Help
Entry
A3K91_2479        CDS       T04320                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pali  Psychrobacter alimentarius
Brite
Enzymes [BR:pali01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A3K91_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3005320..3005949)
Genome map
AA seq 209 aa AA seqDB search
MSNITLPDLPYAKDALEPHISAETLEYHHDKHHAAYVNKLNELLPGSGLEDKTLPEIIEA
TAKDESKQGMFNQAAQVWNHTFYWNCMTPTNGGGEPTGDLKGKIEEDFGSYDKFREEFKN
AALTQFGSGWAWLVADKVGGKLSIAKTANADTPLAHNQVAVLTCDVWEHAYYVDYRNRRP
DYVDTFLDKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattactttaccagatctaccatatgcaaaagacgcattagagccacatatc
agtgcagagacactagaataccatcatgacaaacatcatgctgcttatgtgaacaagcta
aatgagctattaccaggttctggtttagaagacaaaacattgccagaaatcatcgaagca
actgctaaagatgagagcaagcaaggtatgtttaatcaagcagcccaagtatggaaccac
acgttttattggaactgcatgacgccaaccaacggcggcggcgaacctactggcgatcta
aaaggcaaaatcgaagaagatttcggtagctatgacaagttccgtgaagagttcaaaaac
gcagcattgactcaatttggttcaggttgggcatggctagtcgctgacaaagttggtggc
aaattgtctattgccaaaacagctaacgctgataccccacttgcacataatcaagtagcc
gtattgacttgtgatgtatgggaacatgcgtactatgtagattaccgtaaccgtcgtcct
gactatgttgacacgttcctagacaagcttgtgaactgggactacgcaaacgcaaaatat
aaaggtcaagacgctggcgttgaagagtaa

DBGET integrated database retrieval system