KEGG   Pseudomonas alkylphenolica: PSAKL28_04800Help
Entry
PSAKL28_04800     CDS       T03238                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
palk  Pseudomonas alkylphenolica
Brite
Translation factors [BR:palk03012]
 Eukaryotic Type
  Elongation factors
   PSAKL28_04800
 Prokaryotic Type
   PSAKL28_04800
Mitochondrial biogenesis [BR:palk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PSAKL28_04800
Exosome [BR:palk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSAKL28_04800
  Exosomal proteins of breast cancer cells
   PSAKL28_04800
  Exosomal proteins of colorectal cancer cells
   PSAKL28_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
545108..546301
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDALEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagttcgatcgtagtctgccgcacgtgaacgttggcaccattggtcac
gttgaccatggcaagaccacgctgaccgcagcgctgactcgcgtttgctccgaagttttc
ggttcggccgtcgtcgaattcgacaagatcgacagtgctccagaagagaaggctcgtggt
attaccattaatactgcgcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccgggtcacgctgactacgtgaagaatatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccgcaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacactccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcaccaccgctgtcaagaagctggttgagactctggac
agctacatcccagagcctgagcgtgctatcgacaagccgttcctgatgccaatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggacgccctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggcaccaagcgtgacgacgttgagcgtggtcaggttctggtcaagccaggt
tcggttaagccgcacaccaagttcaccgcagaagtttacgttctgagcaaggaagaaggc
ggccgtcatactccgttcttcaaaggctaccgtccacagttctacttccgtactactgac
gtgaccggtaactgcgagctgccagaaggcgttgaaatggtaatgccaggtgacaacatc
cagatgactgtcactctgatcaaaaccatcgcaatggaagatggtctgcgtttcgctatc
cgtgaaggcggtcgtaccgtcggtgctggcgtcgtagcaaagattatcgaataa

DBGET integrated database retrieval system