KEGG   Pseudomonas alkylphenolica: PSAKL28_36410Help
Entry
PSAKL28_36410     CDS       T03238                                 

Definition
(GenBank) peptide synthase
Organism
palk  Pseudomonas alkylphenolica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3988923..4001867)
Genome map
AA seq 4314 aa AA seqDB search
MTDAFELPVTLVQALAQRAAQTPERVALRFLADDPQEAAVLTYRELDLRARTIAGALQAR
TSFGDRAILLFPSGADYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIDDAEPRLL
LTTSALHGSLQALEVLAEEAAPQLLAVDHLDAALADAWQVPALQADDIAFLQYTSGSTAL
PKGVQVSHGNLVANEVLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MAPAYFLARPQRWLQAISDHGGTISGGPDFAYRLCSERVSSAALARLDLSRWRVAYSGSE
PIRQDSLQAFAEKFADCGFSAQSFFASYGLAEATLFVSGSSRGQGIAALTLDAGALARNS
AEPGHDSVQMSCGRSQPGHGVQIVDPQQMTVLGDNQVGEIWACGPSIAKGYWRNPQATAQ
TFVEQGGQTWLRTGDLGFVREGELFVTGRLKDLLIVRGHNLYPQDLEKTLEREVEVLRKG
RVAVFAVDDQGEEGIGVAVEISRNVRKIVSPQSLIKTLRQVIADACQQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRINDGSLDCYARFPDAQQPVAVAQALQGNPLHSLIARLWCEQLG
VEQVADDDHFFLLGGNSIAATQLTARLGDELDLQLSLRVLFDAPLLGDFCSAVAAAQQAG
VAQGAIERLARAQALPQSLAQNRLWLLWQLEPQSAAYNIPGALRLRGELDQAALQSSFQA
LVERHESLRTVFAEIDGQALQRILPALELTVQQLDLSDLDSEAVLARREAEAQQPFDLQA
GPLLRVTLARLDSEAHQLWVTMHHIIADGWSMNILIDEFSRLYAAHCQGQQAELPALTLD
YADYGSWQRQWLAEGEAARQLSYWQTQLGDEQPVLDLATDHPRSSQQHKSAARLSLRVPA
ALTEALRSTARQHDSTLFMILLAGFQSLLHRYSGQADIRVGVPNANRPRLETQGLVGFFI
NTQVLRARFTSRLSFADLLAQVRQTTLQAQEHQDLPFEQLLAAFPDAREQGLFQVMFNHQ
QRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLSFDYASELFDAASVQRL
AAHLLSLLEQVCALPTLAIGDLQLLDAQAREQLLQWGQAPAPAAQQWVVEQLNEQARLTP
QRTALVWEGGALDYAGMHQQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGVLAILKAG
GAYVPLDVDYPGERLAYMLADCGASLLLSHSEVLERLPQVDGVSAIAMDQLNLDSWPCQP
PGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQERYALDEHDVLMQKAPISF
DVSVWECFWPLVSGCKLVLAGPGEHRDPQRIAALVREHAVTTLHFVPALLQVFVQEPLAA
SCTSLRRLFSGGEALSAALRDRVLQVLPQVALHNRYGPTETAINVTHWQCSEADGTRSPI
GRPLANVVCRVVDDELQLTAPGVPGELLLGGAGLARGYLGRPGLTAERFVPHPEGEGQRL
YRSGDRARWVASLGALEYLGRLDQQVKLRGFRVEPEEVEACLLSQPGVEQALVLIRQTVA
GAQLVGYYSGVENNAGLLAALAEQLPAYMVPALLMHLAQMPLGPSGKVERKALPEPLWTT
REHIEPSTALQQQIAAIWREVLGLQQVGLQDDFFALGGHSLLATQIISRTRQACNVELPL
RVLFDATELGAFAREVERIQHSGAHNLQGEIARIDRRQAVPLSYSQQRMWFLWQMEPDSP
AYNVGGMARLRGVLDVSRFEQALQTLIVRHETLRTTFPSIDGVPYQCVHSDSMLQMHWQD
FSADSPAQRELRLQAFADEQAHQSFDLERGPLLRAWLVKAGEHEHYFVLTLHHIVTEGWA
MDIFARELGELYEAFVDERESPLPALPVQYLDYSVWQRQWLEAGEGQRQLDYWKTKLGDE
HPVLELPTDRPRPALQSHRGELYRFDLSPQLATRVRAFNAERGLTLFMTMTATLAVLLYR
YSAQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLNGQMRVAELIDQVRQTVIEGQS
HQDLPFDQLVEALQPARSTAYNPLFQVMCNVQRWEFQQSRQLSGMQVDYLVNDARATKFD
LNLEVTDLDRRLGCCLTYSCDLFDEPRIAQMAAHWQNLLTAMLDNPEQRLCELPMLASTE
QQQLLNSLEGDLDADLEQTIEGQFSAQAARQPQALALTFAGQHLSFAELDARANQLARVL
RKRGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLHYMIEDSGISLLL
AQRSLFAALGELPGQVDRWSLEDDGPALANVSREPLATQSLPGHQAYLIYTSGSTGKPKG
VVVSRGEIAMHCQAVIERFGMRSDDCELHFYSINFDAATERLLVPLLCGARVVLRAQGQW
DAEEICTLIREQQVSVLGFTPSYGSQLAQWLASRNEILPVRLCITGGEALTAEHLQRIRQ
AFTPQQFFNAYGPTETVVMPLACLAPEQLPAGAGSVPIGSVVGARVAYILDADLALLPQG
GIGELYVGGAGLAQGYHERPGLSAERFVADPFSTQGGRLYRTGDLVRQGTDGLVEYVGRI
DHQVKIRGFRIELGEIETRLLEHPAVREAVVQALDMPGGKQLVGYLVCDQAHGDSAVQAA
LRDALKAQLRLHLPDYMVPSHLVLLEQMPLMGNGKLDRRALPAPDLEHGREHYEAPRNAL
EQQLANLWRDVLNVPRVGLQDNFFELGGDSILSIQVVSRARQAGLHFTPRDLFQHQTIQT
LASVVRRSDDNPVDQGPLSGRAALTPIQHWFFDSDVAQPQHWNQAVLLAPAEPLTPKALE
QALQQLVEHHDALRLRFSTQDGQWRGDYLQGESRELLWQVSVNSFADCQPLYSDVQRSLD
LGNGPLLRALLVEDAEGQQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQALAAKTRAMSD
WATRLQAYAGSDSLRDEQHWWQTQLSTAHRELPCDHPQGANLHKQAHTLSLRLDATQTRQ
LLKEAPAAYHTQVNDLLLTALARVLCRWSGDTSVLVQLEGHGRENLFEDMGLTRSVGWFT
SAYPLSLSPAADAGTSIKAIKEQLRQVPHKGLGYGVLRYLADTAVRESMAALPQARITFN
YLGQFDQQFQADALFQPVDEAAGEAHDLEAPLPNWLTVDGQVYAGELQLRWTFSRERYEQ
RTIEQLAEAYKTELLGLIEHCLAPGNGSFTPSDFPLAQLTQEQIDSLPVPAAQIDDVYPL
TPMQEGLLLHTLLEPGTGIYYMQDRYRINSALDPQRFAQAWQAVVARHEALRASFSWNAG
EAMLQIIHKPGGTALDYLDWTDISEVEQETRLQALHKREREAGFDLLQQAPFHLRLIRIG
TDRYWFMMSNHHILIDAWCRSLLMNDFFELYMALGEGREAQLPVPPRYRDYISWLQHQDL
DAARQWWRDNLQGFERSTAVPSDRPLLRDHGAENAGMIVGDCYTRLDVTEGAHLRELAQA
HQLTVNTFAQAAWALVLSRYSGERDVLFGVTVAGRPVSMPQMQRTVGLFINSIALRVQLP
VAGQRCSVRQWLKGLFERNMELREYEYLPLVSIQECSELPKGQPLFDSLFVFENAPVEVS
VLDRAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDTSTVERLLAEFKRLL
LALADGFHGDMSELALLGEQERRLLLEDCNRSERDYPLEQSYVALFEARVAAHPQRTAAR
CLEQSISYAQLNRQANRLGHALVAAGVSIDQPVALLAERDLPLLGMIVGSFKAGAGYLPL
DPGLPTARLQRIVELSRTPVLVCSQACAEQGRALLDELACAGRPKLLVWEQVQNAELSEV
NPGIYSAPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLQLDEHDVIAQTASQS
FDISVWQFLAAPLFGAQVAIVPNSIAHDPQGLLEHVQACGITVLESVPSLIQGMLANEHQ
QLDGLRWMLPTGEAMPPELASQWLQRYPQIGLVNAYGPAECSDDVAFFRVDVASTRGSYL
PIGTPTDNNRLYLLGDDQQLVPLGAVGELCVAGTGVGRGYVSDPLRTALAFIPHPFGAAG
ERLYRTGDLARRRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEVRDAAVGVQEG
VNGKHLVGYLVASDVAADSSVLLELIKQRLRAELPEYMVPLHWAWLKQLPLNASGKLDRK
ALPSVDFAAQQSQDFLAPRNELEQTLATIWAEVLKAGQVGVRDNFFELGGHSLLATQIAS
RVQKALQLNVPLRAMFECSTVEALASYVEGLKASELSDDKVDRLSDLMAELEAL
NT seq 12945 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccggttacgctggtccaggcactggcacaacgtgctgcg
caaaccccggagcgggttgccttgcgctttctggccgacgacccgcaagaggcggcggtg
ctgacctaccgggagctggacctgcgtgcgcggaccattgccggtgccttgcaggcgcgt
acgagctttggtgatcgcgccatcctgctgtttcccagcggagcggattacgtagccgcc
ttctttggctgcctgtacgccggggtcattgccgttccggcatacccgccggagtctgcc
cgtcgtcatcaccaggaacgcctgctatcgatcatcgacgacgccgaaccgcgcctgctg
ctgaccaccagtgccctgcacggcagcctgcaggccctggaggtgctggccgaggaagct
gcgccgcagctgctggcggtcgatcatctggacgcagcactggccgatgcctggcaggta
cccgcgctgcaagccgacgacatcgccttcttgcaatacacctccgggtccacggcgttg
cccaagggcgtgcaggtcagccacggcaatctggtggccaacgaggtgctgatccgccat
ggcttcggcatcgacctcaaccccgacgatgtcatcgtcagctggctgccgctgtatcac
gacatgggcctgatcggcggtttgctgcaaccgatcttcagcggcgtgccttgcgtgctg
atggccccggcctactttctcgcccggccacagcgttggttgcaggcgatcagcgaccat
ggcggcaccatcagtggcggccctgactttgcctatcggctgtgcagcgagcgggtcagc
agtgcggcgctagccaggctcgacctgagccgctggcgggtggcctattccggttccgag
ccgatccgtcaggacagcctccaggcctttgccgagaagttcgctgactgtggtttcagc
gcccagagcttttttgccagctatggcctggcggaggcaaccctgtttgtcagcggcagt
agccgtggccagggtattgctgcgctgaccctggatgccggtgccctggcacgcaacagc
gccgaacctggccatgactcggtgcagatgagttgcgggcgcagccagcccgggcatggc
gtgcagatcgtcgatccgcagcaaatgacggtgctgggcgacaatcaggttggcgagatc
tgggcctgcggtccgagcattgccaaaggctactggcgcaacccgcaagcgactgcgcag
acctttgtcgaacaaggcggacagacctggttgcgcaccggcgacctgggctttgtccgt
gagggggagttgtttgtcaccggccggctcaaggacttgctgattgtacggggtcacaat
ctctacccgcaggatctggagaagaccctggagcgtgaagtcgaggtcttgcgcaaaggc
cgggtggcggtgtttgccgtcgatgaccagggcgaggagggcatcggtgtcgccgtcgaa
atcagccgtaatgtgcggaagatcgtcagcccgcaaagcctgatcaagaccttgcgtcag
gtcattgccgatgcctgccagcaagccccggcggtggtcctgctgctcaacccgggggca
ttgccgaagacttccagtggcaagctgcagcgttctgcctgccggctgcggatcaatgat
ggcagcctcgactgctatgcgcgtttcccggatgcccagcagccggtggcggtcgcgcaa
gcgctacaaggcaacccgttgcacagtctgatcgcgcgcttgtggtgcgagcaactgggc
gtggagcaggtcgccgacgatgaccatttcttcctgcttggaggcaactcgattgccgcc
acccagctaaccgcccgcctgggtgatgaactggacctgcagttgagcttgcgcgtgctg
ttcgatgcgccgctgctgggtgatttctgcagcgctgtcgccgctgcgcagcaggcgggc
gtggcgcagggggcgatcgagcgcctcgcccgtgcccaggcgttgccgcagtcactggcg
caaaatcgcttgtggctgctctggcaactggagccgcagagcgccgcctataacattccg
ggggcgctgcgtttgcgcggcgagctggaccaggcggcgttgcagtccagctttcaggcc
ctggtcgagcgtcatgaatctctgcgtacggtgtttgccgagattgatggtcaggcgctg
cagcgtatcctgccagcgctggagctcactgtgcagcagctggacctgagcgacctcgac
agcgaagcagtactggcgcgacgtgaagccgaagcgcagcaaccgttcgatctgcaagcc
ggtccattgctgcgggtgaccctggcgcgcctggacagcgaagcgcatcagctgtgggtc
accatgcaccacatcattgccgatggctggtcgatgaacatcctcatcgacgaattctcg
cgtctgtacgccgcccactgccaggggcagcaggccgagttgccggcattgaccctggac
tatgccgactatggcagctggcaacggcaatggctggccgaaggtgaagccgcgcggcaa
ctgagctactggcagacacaactgggcgatgaacagccggtgctcgacctggccaccgac
cacccgcgttccagccagcagcacaagtcggccgcacgcctgagcctgcgggtgccggcg
gcgttgaccgaggcgctgcgcagcaccgcccgccagcacgacagcaccctgttcatgatc
ctgttggccggtttccagagtctgctgcaccgctacagcgggcaggccgatatccgtgtc
ggggtgcctaatgccaaccgtccacgcctggaaacccaggggctggtcggttttttcatc
aacacccaggtcctgcgtgcccggttcacctcgcgcctgtcgttcgccgacctgctggcc
caggtccgccagacaaccctgcaggctcaggaacatcaggatctgcccttcgaacaattg
ctggcggccttcccggatgcccgcgaacagggcctgttccaggtcatgttcaaccaccag
cagcgcgatctgagtgctttgcgccgcctgcccgggctgctcgccgaagaactgccatgg
cacagccgcgaggccaagttcgacctgcaactgcacagtgaggaagatcaccaggggcgc
ctgtcgctgtccttcgactacgccagcgagctgttcgacgccgccagcgtgcagcgtctg
gccgcacacctgctgagcttgctggagcaggtctgtgcgctgccgacgttagcgatcggc
gacctgcaactgctcgatgcgcaagcgcgtgagcaactgctgcagtgggggcaggcaccg
gcgcctgcagcgcaacagtgggtcgtcgagcaactcaatgagcaggcacggctgacgccg
cagcgtactgcgctggtgtgggagggcggcgcgctcgactacgccggcatgcaccagcag
gccaaccgcctggcccattatctgcgcgacaagggcgtcggcccggatgtctgcgtggcg
attgccgccgaacgttcgccgcagttgctgatcggtgtgctggcgattctcaaggccggt
ggcgcctatgtgccgctggacgtcgattacccgggcgaacgcctggcttacatgctcgcc
gactgtggtgcgagcctgttgctcagccacagcgaggtgctggagcgcctgccgcaagtg
gatggggtcagtgccattgccatggatcagctcaatctcgacagctggccgtgccagcca
ccggggctgcacctgcacggcgataacctcgcctatgtgatctatacctccggctccacc
gggcaacccaagggcgtcggcaacacccatgcggcactggccgaacgtctgcagtggatg
caggaacgctatgcgctggatgagcacgacgtgctgatgcagaaagcgccgatcagcttc
gacgtttcggtctgggagtgcttctggccgctggtcagcggctgcaaactggtactggca
ggccccggcgagcaccgtgatccgcagcgtattgccgcgctggtgcgcgagcatgccgtg
accaccttgcactttgttccagccttgctgcaggtctttgttcaagagccgctggcggcg
agctgcaccagtttgcgccgtctgttctccggcggtgaggcgttgtctgcggcactgcgt
gaccgggtgctgcaagtgctgccgcaggtggcgctgcataaccgttatggcccgaccgaa
accgcgatcaacgtcactcactggcagtgcagcgaggccgatggcacgcgctcgccgatt
ggccggccgctggccaacgtcgtttgccgggttgtcgatgatgagttgcagctcactgcc
ccgggcgttccgggcgagctgctgctcggtggggccgggctggcacgcggctatctcggc
aggccggggctgaccgccgaacgtttcgtgccgcacccggaaggtgaaggccagcgcctc
taccgcagtggtgaccgggcgcgctgggtggcgtcgctgggagccctggagtacctgggc
cggcttgaccagcaggtgaaactgcgcggctttcgcgtcgagcctgaggaagtggaggcc
tgtctgctcagccagccaggtgttgagcaggcgctggtgctgattcgccagaccgtcgcc
ggggcgcaactggttggctattacagcggcgtggaaaacaatgccggactgttggcggca
ttggcagagcaactgccggcctatatggtcccggcgttgttgatgcacctggcgcagatg
cccctgggcccaagcggtaaggtcgagcgcaaagcgctgccggaaccgctctggaccacc
cgtgaacacatcgaaccgagcaccgcgctgcaacagcagatcgcggcgatctggcgcgaa
gtgctggggctgcaacaggtcggcctgcaggacgacttctttgccctcggcggccattcg
ctgctggcgacccagatcatttcccgcacccgccaggcgtgcaacgtcgagttgccgctg
cgggtattgttcgacgccaccgagctgggcgcatttgcccgcgaggtcgaacgtatccag
cacagcggcgcgcacaacctgcagggcgagatcgcgcggatcgatcgtcgccaagccgtg
ccgttgtcttactcccagcaacgcatgtggttcctctggcagatggaaccggacagcccg
gcctacaacgtcggcggtatggcccgactgcgtggggtgctggatgtcagccgcttcgag
caggccttgcaaaccctgatcgtgcgccatgagaccctgcgcaccaccttcccgagcatc
gacggtgtgccataccagtgcgtgcacagcgacagcatgctgcaaatgcactggcaggac
ttttccgccgacagccctgcccagcgcgagctgcgcctgcaggcctttgccgatgagcag
gcgcatcaatccttcgacctggagcgcggcccgttgctgcgtgcgtggctggtcaaggcc
ggcgagcacgagcactattttgtcctgaccttgcaccacatcgtcactgaaggctgggcc
atggacatcttcgcccgcgagctgggcgagctgtacgaagcctttgtcgatgagcgtgaa
tcgccgctgccggcgttgccggtgcagtacctggattacagcgtctggcagcgccaatgg
ctggaagccggtgaaggccagcgtcagctggattactggaaaaccaaactcggtgatgag
catccggtgctggagctgcccaccgaccgtccacggccagcactgcaaagtcaccgtggc
gagctctatcgctttgacctcagcccgcaactggcgacgcgggttcgcgccttcaatgcc
gagcgcggcctgaccctgttcatgaccatgacggcaaccctggcggtgctgctctatcgc
tacagcgcacagcaggacctgcgcatcggcgcgccggtggccaaccgtatccgtccggaa
agcgaggggctgatcggcgccttcctcaacactcaggtgctgcgctgccagctcaatggg
cagatgcgcgtcgctgagctgatcgatcaggtccgccagaccgtgatcgaaggccagtcg
catcaggacctgccgttcgatcaactggtcgaagccttgcagcctgcgcgcagcaccgcc
tacaacccgttgttccaggtgatgtgcaacgtgcagcgctgggagttccagcagagccgg
caattgtcgggcatgcaggtggactacctggtcaacgacgcccgggcgaccaagttcgac
ctcaacctggaggtcaccgaccttgaccggcgtctgggctgctgcctgacctacagttgc
gacctgttcgacgagccgcgcatcgcgcagatggcggcacactggcagaacctgctgacg
gccatgctcgataatcccgagcagcgtctgtgcgagttgccgatgctggctagcactgaa
caacagcaactgcttaatagcctcgaaggcgaccttgatgcagacctggagcagaccatc
gaaggccagttcagtgcgcaagcggcgcgtcagccacaggccctggcgctgacctttgcc
ggtcagcacctgagctttgccgagctggacgcccgggccaaccagttggcccgggtcctg
cgcaaacgcggtgtaggcccgcaggtacgggtaggcctggcgctggagcgttcactggag
atggtcgtgggcttgctggcgattctcaaggccggtggcgcctatgtgccgctggacccg
gagtacccgctggaacgcctgcactacatgatcgaagacagtggcatcagcctgttgctg
gcgcagcgcagcctgttcgcggcgttgggtgaactgccgggccaggtcgatcgctggagc
ctggaagacgatggcccggcgctggccaatgtcagtcgcgagccgctggccacacagagt
ctgccgggccatcaggcctacctgatctacacctcaggctccaccggaaaacccaaggga
gtggtggtcagccgtggcgagatcgccatgcattgccaggcggtcatcgaacgtttcggc
atgcgtagtgacgactgcgaactgcacttctattcgatcaactttgacgccgctaccgag
cgcttgctggtgccgctgctgtgcggcgcgcgggtggtcttgcgcgctcagggacagtgg
gacgccgaagaaatctgcaccttgattcgcgaacagcaggtgtcggttctcggctttacc
ccgagctatggcagccaactggcgcagtggctggccagccgcaacgagatcctgccggta
cgcctgtgcatcaccggtggcgaagccctgaccgctgagcacctgcagcggatccgccag
gcgttcacgccacagcagttcttcaatgcctatggaccgaccgaaaccgtggtcatgccg
ctggcgtgcctggcaccggaacaattgccagccggtgccggtagtgtgccgatcggcagc
gtggtcggtgcccgagtggcttacattctcgatgccgatctggcgctgctaccccagggt
ggcattggtgaactgtatgtcggcggcgccggcctggcccagggttaccatgagcgaccg
gggctcagtgccgaacgctttgtcgccgacccgttcagtactcaaggcgggcgcttgtac
cgtaccggcgacctggtgcgtcagggcaccgatgggctggtcgagtacgttggccgtatc
gaccatcaggtgaagattcgtggtttccgtatcgaactgggggaaatcgagacgcgcctg
ctggagcatccggcggttcgcgaggcagtcgtgcaggccctggacatgccgggcggcaaa
cagctggtcggctacctggtctgcgatcaggctcatggcgatagcgctgtgcaggctgcg
ctgcgtgatgcactgaaggctcagcttcgactgcacctgccggactacatggtgcccagc
catctggtgctgcttgagcagatgccactgatgggcaatggcaagcttgaccgccgtgcc
ctgccagcgcctgatctggaacacggacgtgagcactatgaagcaccgcgcaacgcgctg
gagcagcagctggccaacctctggcgcgatgtgttgaacgtgccgcgggtcggcttgcag
gacaacttcttcgaactgggcggtgactcgatcctgtcgatccaggtggtcagtcgtgcg
cgtcaggcagggctgcatttcaccccgcgcgatctgttccagcaccagaccatccagacc
ttggccagtgtggtgcgccgcagcgacgacaacccggtcgatcaagggccactgagcggt
cgcgcggcgctgacgccgatccaacactggttcttcgacagcgatgtagcgcagccccag
cactggaaccaggcggtattgctggcgccggccgaacctctgacgcccaaggcgctggag
caggccttgcagcaactggtcgagcatcacgacgcgctgcgcctgcgctttagcacgcag
gatggccaatggcggggcgactatctccagggtgaaagccgcgagctgctctggcaggta
tcggtcaacagttttgccgactgccagccgctgtacagcgatgtgcagcgcagcctggac
ctgggcaacggtccactgctgcgggcgttgctggtcgaagacgccgaaggtcagcagcgc
ttgctgttggcgatccatcacctggtggtcgatggtgtgtcgtggcgggtgctgcttgag
gatttgcaggcgctttaccgtggccaggcattggcggcgaaaacccgcgccatgagcgat
tgggccacacgcctgcaggcctatgctggcagtgattcactgcgcgacgaacagcactgg
tggcagacccaactgagcacggctcaccgtgaactgccatgcgaccatccgcaaggggcg
aacctgcacaagcaggcgcacaccctgagcttgcgcctggatgccacacagacccggcaa
ctgctcaaggaagcaccagcggcctaccacacccaggtcaacgacctgttgttgaccgcc
ctggcccgggtgctgtgccgctggagcggtgacacctcggtgctggtgcaactggaaggc
catggccgggaaaacctcttcgaggacatgggcctgacccgcagtgtcggctggttcacc
agtgcctatccattgagcctgagccctgcagctgatgccggaacgtcgatcaaggcaatc
aaggaacaactgcgccaggtgccgcataaggggctgggttacggtgtgctgcgttacctc
gccgatactgcggtacgcgaaagcatggcggcgttgccgcaagcgcggatcaccttcaac
tacctcggccagttcgaccagcaattccaggccgatgcgctgttccagccggtggatgaa
gcggccggcgaggcccatgacctggaggcgccgctgcccaactggttgactgtcgatggc
caggtctacgccggtgaattgcagctgcgctggactttcagccgtgagcgctatgagcaa
cgcaccattgaacaactggccgaggcatataaaaccgaactgctcggcttgatcgaacac
tgcctggctcctggaaatggcagcttcacgccgtcggacttccccctggcgcaactgacc
caggagcagatcgacagcctgcccgtgcctgcggcgcagatcgacgatgtgtacccactg
acgcccatgcaggaagggctgttgctgcataccctgcttgagcccggcaccggcatctac
tacatgcaggaccgctaccggatcaacagcgccctcgacccgcagcgctttgcccaggcc
tggcaagcggtggttgcgcgccacgaagccctgcgtgcgtcattcagctggaacgctggc
gaagccatgctgcagatcatccacaaaccgggcggtactgcgctcgactatctggactgg
accgacatcagcgaagtcgagcaggaaacgcgcctgcaggccctgcacaagcgggagcgc
gaagcaggcttcgatctgctgcaacaggcgccgttccacttgcgcctgattcgcatcgga
acagaccgttactggttcatgatgagcaaccaccacatcctcatcgatgcctggtgccgc
tcgttgctgatgaacgatttcttcgagctgtacatggccctgggcgaaggccgcgaggcg
cagttaccagtgccgccgcgctaccgcgactacatcagctggttgcagcaccaggacctc
gacgccgcgcgtcagtggtggcgcgacaacctgcagggcttcgagcgcagcaccgcggtg
ccgagcgaccggccgctgctgcgtgatcatggcgccgagaacgccgggatgatcgtcggt
gactgttacacccgccttgatgtgactgaaggggcgcacctgcgtgagctggcccaggcc
catcagttgaccgtcaacacctttgcccaggcggcctgggcgctggtattgagccgttat
agcggcgagcgcgacgtgctgttcggggtcaccgtggccggtcgtccggtgagcatgccg
cagatgcagcgcacggtcgggctgttcatcaacagtatcgccctgcgcgtgcaactgccg
gtggcgggtcagcgttgcagtgtgcgccaatggctcaagggcctgttcgaacgcaacatg
gagttgcgcgaatacgagtatctgccgctggtgagcattcaggaatgcagtgagctgccc
aagggccagccattgttcgacagcctgttcgtgttcgaaaacgccccggtggaagtctcg
gtactggaccgtgcgcaacacctgaatgccagctccgattccggtcgcacccacaccaac
ttcccgctgactgcagtctgctaccccggcgatgacctggggctgcacctgtcgttcgat
cagcgctatttcgacacctcgacagtcgagcgcttgctggccgagttcaagcgtctgttg
ctggccctggccgatggtttccacggcgacatgagcgagctggcgttgctgggtgaacag
gagcgccgtttgctgttggaagactgcaaccgcagcgaacgggattacccgctggagcag
agttacgtagcgctgttcgaggcgcgggtcgctgcccatccgcagcgtactgccgcacgg
tgtctggagcagtcgatcagctatgcacagctcaatcgccaggccaaccgcctggggcat
gcgctggtggctgccggggtgagtatcgaccagccggtggcgctgctggccgagcgcgat
ttgccgttgctggggatgatcgtcggcagcttcaaggcgggtgccgggtacttgccgctt
gatccgggcttgccgacggcgcgcctgcaacgcatcgtcgaactcagccgtacgccagtg
ctggtctgcagtcaggcctgcgccgagcagggccgcgcgctgctggatgagctggcctgc
gcggggcggccgaagttgctggtctgggagcaggtgcagaacgccgagctatccgaggtc
aacccaggcatctacagcgccccggacaacctcgcctacgtgatctacacctccggctcc
acgggcttgccgaagggcgtgatggtcgagcagcgcggcatgctcaacaaccagttgagc
aaggtgccgtacctgcaactggacgagcacgacgtgattgcccagaccgcctcgcagagt
ttcgacatttccgtctggcagttcctcgccgcgccgttgttcggtgctcaggtggcgatt
gtgcccaacagcattgcccacgatccccagggcctgcttgagcacgttcaggcttgcggg
atcacggtgctggaaagcgtgccgtcactgatccagggcatgctcgccaacgagcatcag
caactcgacggcttgcgctggatgctgccaaccggggaggcgatgccacccgagctggcg
tcgcagtggctgcagcgctatccgcagatcggcctggtcaatgcctacggcccggcggaa
tgttccgatgacgtggcgttcttccgtgtcgatgtggcctcgactcgcggcagctatcta
cctatcgggacgccgaccgacaacaaccgcctgtacctgctcggtgacgatcagcaactg
gtgccactgggggccgtcggtgaactctgtgtggccggtaccggcgtcgggcgcggctat
gtcagcgacccgctacgcaccgccctggcattcattccgcatccattcggggcagcgggc
gaacgcctgtaccgcacgggtgacctggcgcggcgccgtccggatggtgtgctcgaatac
gtcgggcgtattgaccatcaggtgaagatccgtggctaccgtatcgagctgggtgagatc
gaagcgcgcctgcatgagcaggccgaggtgcgcgacgcagcggtgggggttcaggaaggg
gtcaatggcaagcatctggtgggctatctggtggccagcgatgtggcagcggacagcagt
gtactgctcgagctgatcaagcaacggttgcgtgctgaactgcccgagtacatggttccg
ctgcactgggcctggctcaagcaactaccgctcaatgccagcggcaagctcgaccgcaag
gcgctgccaagcgttgatttcgccgctcagcagagtcaggacttcctcgctccgcgcaac
gaactggagcagaccctggcgacgatctgggccgaggtgctcaaggccgggcaggtcggg
gtgcgcgacaacttcttcgagttgggcggccactccctgctggctacgcagatcgcttcg
agggtgcagaaggcgctgcaactgaacgtgccgttgcgggcgatgttcgagtgcagcacc
gttgaggcgctggcgagctacgtggaaggcctcaaggccagtgagctgagcgacgacaag
gtcgaccggctcagtgacctgatggctgagcttgaggcgctatag

DBGET integrated database retrieval system