KEGG   Pseudoalteromonas aliena: B0W48_00135Help
Entry
B0W48_00135       CDS       T04815                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00240  Pyrimidine metabolism
paln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paln00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B0W48_00135
Enzymes [BR:paln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B0W48_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 KdpD AAA_14 DUF4528
Motif
Other DBs
NCBI-ProteinID: AQP98340
UniProt: A0A1Q2GTL8
LinkDB All DBs
Position
23984..24577
Genome map
AA seq 197 aa AA seqDB search
MAQLYFYYSAMNAGKSTTLLQSAFNYKERGMEPVILTAAIDDRQGVGKVSSRIGLQADAH
VFDASKDVFDLIQSLHNDKKRHCVLVDECQFLSKEQVMQLTDVVDELGIPVLCYGLRNDF
RGELFVGSQYLLAWADKLVELKTVCHCGRKANHVLRTDENGEAIADGNQVEIGGNDRYVS
VCRKHYKAALNMGRQSI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatacttttactactctgcaatgaatgcaggtaaatcaaccacgttatta
caatctgcatttaattataaagaacgtggcatggaacctgtgatccttactgctgctatt
gatgatagacaaggcgtaggtaaagtatcgtctcgtattggtttacaagctgatgcgcat
gtatttgatgctagcaaagatgtatttgatcttattcaatctctccataatgataaaaag
cgccactgtgtgttggtcgatgaatgtcaatttttatcaaaagaacaagtcatgcaatta
accgatgtggttgatgagttaggtataccggtactgtgctatggcttgcgtaacgatttt
agaggcgagctatttgtagggtcgcaatacttgcttgcgtgggctgataagttagtagag
cttaaaactgtctgtcactgtggacgaaaagctaaccatgtactgcgtaccgatgaaaac
ggtgaagcaatagccgatggcaatcaagtagaaattggcggcaatgaccggtatgtttcg
gtatgccgcaaacactataaagcggcgttaaatatgggccgacaaagcatttaa

DBGET integrated database retrieval system