KEGG   Podospora anserina: PODANSg09764Help
Entry
PODANSg09764      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pan  Podospora anserina
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PODANSg09764
Enzymes [BR:pan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PODANSg09764
Transporters [BR:pan02000]
 Other Transporters
  Pores ion channels [TC:1]
   PODANSg09764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 257 aa AA seqDB search
MTATLNPPKPIRVWLTPPGPNGWKTIFLLEELSLNYVFKSFRFDDVKKPPFIDINPNGRI
PAIEDPNTGLTLWESGAINQYLIEQYDTEKRLTFDDVINRNLCNQFLQFQMSGQGPYYGQ
CGWFQHLHAEKIQSAIDRYSNEIKRVLGVLEIVLSKKGEHEQWLVGDKMTYADMAFVPWN
SRLSEVLMQLWDEVFEGTPRVRAWHEKMVELPSWKRAMEHRARLMDEQGLQWNGVPKGIE
TFTEYEEKIEKGEMKYD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacagctactctcaaccctcctaaacccatccgtgtatggctcaccccaccgggcccc
aatggctggaaaaccattttcctccttgaggaactctcccttaactacgtgttcaaatcg
ttccgcttcgatgacgtgaagaaaccccctttcatagacatcaaccccaacggccgcatc
ccggccatcgaagaccccaacaccggtctcaccctttgggagtcgggagccatcaaccag
tacctcatcgagcaatacgacacggagaagcgtctcacatttgacgatgtcatcaaccgc
aacctctgcaaccagttcctccagttccagatgagcggccaaggaccctattacggtcag
tgcggctggttccagcatttacatgctgagaagatccagtcggctattgataggtattct
aatgagatcaagcgtgtgttgggggtgttagagattgttttgtcgaagaaaggggagcat
gagcagtggctggtcggggacaagatgacgtatgctgatatggcgtttgtgccttggaat
tctcggttgagcgaggtgctgatgcagttgtgggatgaggtcttcgagggaacaccgcgt
gttcgggcctggcatgaaaagatggtcgagctgccgagttggaagagggctatggaacat
cgtgcgagactcatggatgagcaagggctgcagtggaatggtgtgccgaaggggatcgag
acatttactgagtacgaggagaagattgagaagggggagatgaagtatgactag

DBGET integrated database retrieval system