KEGG   Podospora anserina: PODANSg6064Help
Entry
PODANSg6064       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pan  Podospora anserina
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PODANSg6064
  Lipid metabolism
   00600 Sphingolipid metabolism
    PODANSg6064
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PODANSg6064
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PODANSg6064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 869 aa AA seqDB search
MSSRCAASSVVRQLLVAVVLFIVGVLAQAATRERISLNADWRFQRFTSNPDNLNYNTLKP
WLTPSANNFINDASRRTKRPSNEPPNVTYTQANFNDNSWEALSLPHDWAVKGPFYVGNNV
PVGGNMGRLPIQGVGWYRKKFTLNPGDEGKSVYLEVDGAMSYAAVWINGKIAGGWPYGYA
SFRVDLTPYLQSGSNQLAIRLDQAVESSRWYPGAGIYRNVWLTKVNPIHVGQFGTFVKTR
SSSAQTATLDLTVQVENSATTAAAGQVQVVTDIHSYDAVSGKAGAKIGGFSNATVSVSPG
SIASVNASATVQNPKLWGPRPTQEPNMHVAITRLYVGDQLVDTYETPFGIRSLQYLGDGL
RVNGQRVYIQGVCQHHDLGSLGAAFNIPAARRQLEMLQDMGTNAMRTSHNPPAPELLDLA
DKMGFLVLDEIFDTWGSHKTRNDFQTIFADWSEPDLRAFVRRDRNHPSIWAWSFGNEVAE
QGSSNGAAQAERLRNIVRQEDATRQSTVGMNNAGPDTAFVSIVDLIGLNYQGEGKGNGAP
TFENFRGRFPNKLIFSTESSSVVSSRDTYLFPVVNSNNAIVRANGPGADPTTRQVSSYDL
YAMEWGASPDKVFVAQDRYSYVAGEFVWTGWDYIGEPTPYDSSRSSYFGIIDLAGFPKDR
FYLYQSRWNPSVKIAHILPHWNWPNRVGQVTPVHVYSSGDEAELFVNGKSQGRQKKAQYT
YRFRWDQVTYQPGEVRVVTYKDGNEWANATVRTTGTASQLRLSTYHNRATIKADGEDLSF
VSVAVVDDKGDVVPTAEPNITFSITGPGDIVTTDNGDSTDMVAFPSKERKAFRGRALAIV
RAKVGASGAITVAATANGVKSAEVVLQVE
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcgctgtgcggcctccagtgtcgtgcggcaactgctggtagcagtggtgctt
ttcatcgttggagtcctcgcacaagcagcaactcgcgaaagaataagcttgaacgcggac
tggcgtttccaacgcttcacctcgaatcctgacaacctcaactacaacaccctgaagcca
tggcttacaccatcagccaacaacttcatcaatgatgcctcccgccgcaccaagcgccca
tccaacgagccacccaacgtcacctacacccaagcaaacttcaatgataactcgtgggaa
gccctgagtctgcctcacgactgggctgtcaaaggacctttctatgtcggcaacaatgtt
cccgtcggaggaaacatgggtcgtcttcccatccagggggttggatggtaccgcaagaag
ttcacgctcaacccgggcgacgaggggaaatctgtgtatctcgaggttgacggcgccatg
tcctatgctgcggtctggatcaatgggaagatcgctggtggatggccgtatggctatgcc
tcattccgtgtcgacctcactccgtatctgcagtccggaagcaatcagctagctattcgc
cttgaccaagccgttgagtcgtcgcgatggtatccaggtgcagggatctaccgcaacgtt
tggttgaccaaagtaaaccccatccacgtcggccagttcggtaccttcgtcaaaaccagg
agctcgtcagctcaaacggcaacgcttgacctcactgttcaggtggagaacagcgcaaca
accgccgcagcaggtcaggtccaggtcgtcactgacattcattcttacgatgcggtctcg
gggaaggcgggagcaaagatcggtggtttctctaacgccacagtcagcgtctccccaggg
tctattgcatctgtgaatgcatcagcgactgtgcagaacccaaagctttggggtccacgt
ccgacgcaggagcccaatatgcatgttgccatcacccgtctttacgttggggaccagctg
gtagacacatacgaaactcctttcggcatccgctctctgcagtaccttggcgatggactg
cgtgtcaacggtcagcgcgtgtacattcagggtgtttgccagcaccatgatcttgggtcg
ttgggagccgccttcaacattccggctgctcggcgtcagctggagatgctccaggatatg
ggaaccaacgcgatgagaacctcacacaatcctccagcgcctgagctgctcgatcttgct
gacaagatgggtttccttgttctggacgagatcttcgacacgtggggcagccacaagact
cgcaacgatttccagaccatctttgccgactggtctgagccagatctcagagcgtttgtt
cgccgtgaccgcaaccatccttcaatttgggcctggtcctttggaaacgaggtcgcagag
cagggaagcagcaacggtgcagcacaagctgagcgtcttcgaaatattgttcgccaggag
gacgccaccagacagtccaccgtcggaatgaacaacgctgggcctgacacggcctttgtc
tcgattgttgatcttatcgggttgaactatcagggagagggcaaaggaaacggcgcgcca
acgttcgaaaacttccggggacggttccctaacaagttgatcttcagcactgagagctcg
tcggtggtcagctccagggacacatacctcttcccagtggtgaacagcaacaacgcgatt
gtacgggcgaatggtcctggcgccgatcctactactagacaagtcagttcgtatgacctg
tacgccatggaatggggtgcttcacctgacaaggtctttgtggcacaagatcggtattcg
tacgttgcgggtgagtttgtttggacaggctgggattacattggagagccgacgccatat
gattcctctcggagcagctactttggcatcatcgaccttgctgggtttcccaaggaccgg
ttctacctttaccagtcaagatggaacccaagcgtgaagatagcccacatcctgcctcac
tggaactggcccaatcgcgtcggtcaagtcacgcctgttcatgtgtactcttcgggtgac
gaagccgagcttttcgtcaacggcaagtcccagggtcgacagaagaaggcgcagtacacc
tatcgtttccggtgggaccaggtcacctaccagccaggagaggtgcgtgtcgtgacatac
aaggatgggaatgaatgggcgaatgcgacagttcggactaccgggacggcctctcagttg
cggttgtcgacgtatcataaccgcgcgacgatcaaagctgacggcgaggatctctctttt
gtcagtgttgctgtcgtggacgacaagggcgatgttgttcccaccgcggaacccaacatc
acattttccatcactgggcctggtgacattgtcactacggataatggagactcgactgat
atggttgcgttcccgtcaaaggagaggaaagcgtttcgaggacgagcgttggctattgtg
cgtgcaaaggttggagcatcgggggcgattacagtggcggccacggcgaatggtgtcaag
tcggcggaggttgtgctacaggtggaatag

DBGET integrated database retrieval system