KEGG   Pantoea sp. PSNIH2: PSNIH2_16810Help
Entry
PSNIH2_16810      CDS       T03514                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00620  Pyruvate metabolism
panp00680  Methane metabolism
panp01100  Metabolic pathways
panp01120  Microbial metabolism in diverse environments
panp01200  Carbon metabolism
Module
panp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:panp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSNIH2_16810
  Energy metabolism
   00680 Methane metabolism
    PSNIH2_16810
Enzymes [BR:panp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSNIH2_16810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIX75256
UniProt: A0A0A1B3E2
LinkDB All DBs
Position
3625075..3627726
Genome map
AA seq 883 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNDAHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNVAEQYQTISPHGEGANHPELMKKAFERLKQQPDLNES
NIREAIESLSLELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDISDYERNQIMRRLRQ
LVAQAWHTDEIRKYRPSPVDEAKWGFAVVENSLWDGVPGFLRELNEQVEESFGYTLPVDF
VPVQFTSWMGGDRDGNPNVTASITRHVLQLSRWKATDLFLRDIGVLISELSMSECTDELR
ELCGDPQAQEPYREILKRLRTQLMTTQSYLERRLKGERLPRPEGLLISNDQLWEPLYACY
QSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDLRQESTRHTEAIAEITRYLGLGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCRVAAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIPFALPVAPLFETLDDLNNANDVMSQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGTIGRGGAPAQAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVAIASLSLYTSAILEANLLPPPEPKSEWRSIMDQL
SDVSCGIYRGYVRENPDFVPYFRSATPEQELGKLPLGSRPAKRRPSGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQQAMDEGHRDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVDVSLWPLGKQLRDRLEADIKAVLTIANDAHLMADEPWIAESIALRNVYTDPLN
VLQAELLHRSRAQEARGEEVDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtatgctcggcaaactgctcggg
gatacgattaaggatgcgctgggagaaaacatccttgatcgggtggaaaccatccgcaaa
ctctctaagtcatcccgcgcgggaaacgatgctcatcgccaggagctgcttaccacgctg
caaaatctctctaatgatgaacttctgccggtcgcgcgcgcctttagccagttcctcaat
ctgaccaacgtcgccgaacagtaccagaccatttcgccgcacggcgaaggcgccaatcat
cctgaattgatgaaaaaagcgttcgagcgtcttaagcagcagcccgatctgaatgaatcc
aatatccgcgaagccatcgaatccctttcgctggaactggttctgaccgctcaccccacc
gaaattacacgccgcaccctgattcataaactggttgaggtaaatacctgcttaaagcag
ctcgaccataacgatatttccgactacgagcgcaaccaaatcatgcgccgtttgcgtcag
ctggtggctcaggcctggcataccgacgaaatccgcaagtatcgcccctctcccgtcgac
gaagccaaatggggctttgcggtggtggaaaacagcctgtgggatggcgtgcctggtttt
ttgcgcgaactgaacgagcaggttgaagaaagcttcggctatacgctgccggtcgatttc
gtgccggtgcagttcacctcctggatgggcggcgaccgtgacggcaacccgaacgtcacc
gccagcattacccgtcacgttctgcagctgagccgctggaaagcgaccgaccttttcctg
cgcgatattggcgtgctgatttccgagctgtcgatgtcggaatgtaccgatgaactgcgc
gagctgtgcggcgatccgcaggcgcaggagccttaccgtgaaattctgaaacgtctgcgc
acgcagctgatgactacgcagtcttatctggagcgccggctgaaaggcgaacgtctgccg
cgcccggaagggctgctgatctcgaacgatcagctgtgggagccgctttatgcctgttat
cagtcgttacaggcgtgcggcatgggcattatcgctaacgggcaactgcttgatacgctg
cgccgggtaaaatgtttcggcgtgccgctggtgcgcatcgacctgcgtcaggaaagcacc
cgtcacaccgaagcgatcgccgagataacgcgctatctggggctgggcgattatgagagc
tggtccgaagcggacaagcaggctttcctgatccgcgagctgaactccaaacggccgctg
ctgccgcgccagtgggaacccagcgaggaaacgcgcgaggtgctggatacctgtcgcgtc
gccgctgaagcgccgcgcggttctatcgccgcctatgttatctcaatggcgaaaacgccg
tctgacgtgctggcggttcacctgctgctcaaagaggcgggcattccgttcgcgctgccg
gttgcgccgctgtttgaaacccttgatgacctgaataacgccaatgatgtgatgtcgcag
ctgctcaacatcgactggtatcgcggctttatccagggcaagcagatggtaatgatcggc
tattccgattcggccaaagacgcaggcgtgatggcggcttcctgggcgcagtatcaggcg
caggacgcgttaatcaagacctgcgaaaaggcgggcattgcgctgaccctgttccacggc
cgcggcggcactatcggtcgcggcggcgcgcctgcgcaggcggcgctgctttcacagccg
ccgggcagtctgaaaggcggcctgcgcgttaccgagcagggagagatgatccgctttaaa
tatggtctgccggaggtggcaatcgccagcctgtcgctctataccagcgccattctggaa
gccaacctgctgccgccgccggagccgaaaagcgaatggcgcagcattatggatcagctt
tccgacgtctcctgcggcatttaccgcggctacgtgcgtgaaaatcctgatttcgttccc
tacttccgctccgccacgccggaacaggagctgggtaagctgccgttgggctcgcggcca
gccaagcgccggccaagcggcggcgtcgaatcgctgcgcgccattccctggatcttcgcc
tggacgcaaaaccgtctgatgctgcccgcctggctgggcgccggtgcggcgctgcagcag
gcgatggacgaaggccatcgggatcagctggaggcgatgtgtcgcgactggcccttcttc
tctacccgcctcggcatgctggagatggtcttttccaaagcagatttatggctggctgaa
tattatgaccagcgtctggtcgacgtttcactgtggccgctgggcaagcagctgcgcgat
cgtctggaagcggacattaaagcggtgctgactatcgccaatgatgcgcatctgatggcg
gacgagccctggattgcagaatctatcgctctgcgcaacgtctataccgacccgcttaac
gtactgcaggctgagctgctacaccgctcccgcgcgcaggaagcacgtggtgaagaggtg
gatccgcgcgttgaacaggcgctgatggtgaccatcgccggcgtcgccgccggtatgcgc
aacaccggttaa

DBGET integrated database retrieval system