KEGG   Pantoea sp. At-9b: Pat9b_2202Help
Entry
Pat9b_2202        CDS       T01386                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_2202
Enzymes [BR:pao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pat9b_2202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADU69512
JGI: Pat9b_2202
UniProt: E6WF91
LinkDB All DBs
Position
2406731..2407606
Genome map
AA seq 291 aa AA seqDB search
MQESLFSLPVVQQITPYLSQRQIGELPVIIVSHPRVRAAITLQGAHLLAWQPSGQQPVLW
LSEKTPFATGKAIRGGVPICWPWFGPAGEPAHGFARNQPWTLSAHDENEEGVILTFALES
NPQTLKLWPHDFTLLARFRIGAHCEIELEAHGDFEATAALHSYFQVTDIAQTEVSGLGNS
FIDKVNDSAIGESNGKQTYPGRIDRVFTAPEDYSVIHDKAGNRQIEVYHHYQSDVVTWNP
GPELSCSMADMANDGYKTMVCVETARINQPLVSAGESPARLATTFRLRSKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagtcacttttttcgctacccgtagtccagcagatcaccccttatttgtctcag
cgccagataggtgagctgcccgtgattatcgtcagccatcctcgcgtgcgcgccgccatt
accttgcagggcgcacatctgctcgcctggcaacccagtgggcaacagcccgttctgtgg
ctcagcgagaagacgccgtttgccaccgggaaagccatccgtggtggtgtaccaatctgt
tggccgtggtttggcccggccggtgaacccgcgcacggttttgcccgtaatcagccctgg
acattatccgcgcatgacgagaatgaagaaggcgtcattctgacctttgcgctggagagt
aatccacaaaccttaaaactctggccgcacgattttaccctgctcgcgcgcttccgcatt
ggtgcccattgcgaaattgagctggaagcgcatggcgattttgaggctactgcggcgctg
cacagctatttccaggtaacggacattgctcaaacagaagtcagcggcctgggtaacagc
ttcatcgataaggtgaatgacagtgcgattggcgaatcaaacggtaagcagacctatccc
ggtcgcatcgatcgcgtcttcaccgcgccggaagattacagcgtgattcatgataaagcg
ggcaaccgtcagattgaggtttaccaccactatcaaagtgacgttgtcacgtggaatccc
gggccggaattatcgtgcagcatggctgacatggcgaatgacggttacaaaaccatggtg
tgcgtggaaaccgcccgtattaatcagccgctggtgagcgccggtgaatcccctgcccgc
ctggcaaccaccttcagattgcgcagcaaagcctaa

DBGET integrated database retrieval system