KEGG   Pseudomonas aeruginosa PA7: PSPA7_4898Help
Entry
PSPA7_4898        CDS       T00569                                 

Gene name
pyk1
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPA7_4898 (pyk1)
   01230 Biosynthesis of amino acids
    PSPA7_4898 (pyk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_4898 (pyk1)
   00620 Pyruvate metabolism
    PSPA7_4898 (pyk1)
  Nucleotide metabolism
   00230 Purine metabolism
    PSPA7_4898 (pyk1)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     PSPA7_4898 (pyk1)
Exosome [BR:pap04147]
 Exosomal proteins
  Proteins found in most exosomes
   PSPA7_4898 (pyk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
5051250..5052701
Genome map
AA seq 483 aa AA seqDB search
MSVRRTKIVATLGPASNSPEVLEQLILAGIDVARLNFSHGTPDEHRARARLVRELAARHG
RFVALLGDLQGPKIRIAKFASKRIELQVGDRFRFSTSHPRDAGTQEVVGIDYPDLVKDCG
VGDELLLDDGRVVMVVEEVAADELRCRVLIGGPLSDHKGINRRGGGLTAPALTDKDKADI
KLAADMDLDYVAVSFPRDAKDMEYARSLLTEAGGKAWLVAKIERAEAVADDDALDGLIRA
SDAVMVARGDLGVEIGDAELVGIQKKIILHARRNNKVVITATQMMESMIHSPMPTRAEVS
DVANAVLDYTDAVMLSAESAAGEYPVEAVKAMARVCQGAEKHPTSQKSSHRLGQTFDRCD
ESIALASMYTANHFPGIKAIICLTESGFTPLIMSRIRSSVPIYAYSPHRETQARVAMFRG
VETIPFDPAALPPEKVSQAAVDELLKRGVVTKGDWVILTKGDSYTAQGGTNTMKVLHVGD
LLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgccgcaccaaaatcgtcgccaccctcggcccagccagcaattccccggaa
gtgctggagcagctgatcctggccgggatcgacgtcgcccgcctcaacttctcccacggc
acccccgatgaacaccgtgcccgcgccaggctggtgcgcgagctggcggccaggcacggc
cgcttcgtcgccctgctcggcgacctgcaaggaccgaagatccgcatcgccaagttcgcc
agcaagcgcatcgaattgcaggtcggcgacaggttccgcttctccaccagccacccgcgc
gacgccggcacccaggaagtggtcggcatcgactatccggacctggtgaaggactgcggt
gtcggcgacgaactgctgctggacgacggccgggtggtgatggtggtcgaggaagtcgcc
gccgacgaactgcgctgccgggtgctgatcggcggcccgctgtccgaccacaagggcatc
aaccgccgcggcggcggtctcaccgcgccggcgctgaccgacaaggacaaggccgacatc
aagctggccgcggacatggacctggactacgtggccgtttccttcccgcgcgacgccaag
gacatggaatacgcccgcagcctgctcaccgaggccggtggcaaggcctggctggtggcc
aagatcgaacgcgccgaagcggtggccgacgacgacgccctcgacggcctgatccgcgcc
agcgacgcggtgatggtggcgcgcggcgacctcggcgtggaaatcggcgatgccgagctg
gtcggcatccagaagaagatcatcctgcacgcccgccgcaacaataaagtggtgatcacc
gcgacccagatgatggagtcgatgatccacagcccgatgccgacccgcgcggaagtctcc
gacgtggccaacgccgtactcgactacaccgacgcggtgatgctctcggcggaaagcgcc
gccggcgaatacccggtggaagcggtgaaagccatggcccgcgtctgccagggcgccgag
aagcacccgaccagccagaagtccagccaccgcctcggccagaccttcgaccgctgcgac
gagagcatcgccctggcgtcgatgtataccgccaaccacttcccggggatcaaggcgatc
atctgcctgaccgaaagcggcttcaccccgctgatcatgtcgcgcatccgctcctcggta
ccgatctacgcctattccccgcaccgcgagacccaggcccgcgtggccatgttccgcggc
gtggagaccatccccttcgacccggccgcgctgccaccggaaaaggtcagccaggccgcg
gtcgacgaactgctcaagcgcggcgtggtgaccaagggcgactgggtgatcctgaccaag
ggcgacagctataccgcccagggcgggaccaacaccatgaaggtcctgcacgtcggcgac
ctgctggtataa

DBGET integrated database retrieval system