KEGG   Pseudomonas aeruginosa PA7: PSPA7_4898Help
Entry
PSPA7_4898        CDS       T00569                                 

Gene name
pyk1
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPA7_4898 (pyk1)
   01230 Biosynthesis of amino acids
    PSPA7_4898 (pyk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_4898 (pyk1)
   00620 Pyruvate metabolism
    PSPA7_4898 (pyk1)
  Nucleotide metabolism
   00230 Purine metabolism
    PSPA7_4898 (pyk1)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     PSPA7_4898 (pyk1)
Exosome [BR:pap04147]
 Exosomal proteins
  Proteins found in most exosomes
   PSPA7_4898 (pyk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
5051250..5052701
Genome map
AA seq 483 aa AA seqDB search
MSVRRTKIVATLGPASNSPEVLEQLILAGIDVARLNFSHGTPDEHRARARLVRELAARHG
RFVALLGDLQGPKIRIAKFASKRIELQVGDRFRFSTSHPRDAGTQEVVGIDYPDLVKDCG
VGDELLLDDGRVVMVVEEVAADELRCRVLIGGPLSDHKGINRRGGGLTAPALTDKDKADI
KLAADMDLDYVAVSFPRDAKDMEYARSLLTEAGGKAWLVAKIERAEAVADDDALDGLIRA
SDAVMVARGDLGVEIGDAELVGIQKKIILHARRNNKVVITATQMMESMIHSPMPTRAEVS
DVANAVLDYTDAVMLSAESAAGEYPVEAVKAMARVCQGAEKHPTSQKSSHRLGQTFDRCD
ESIALASMYTANHFPGIKAIICLTESGFTPLIMSRIRSSVPIYAYSPHRETQARVAMFRG
VETIPFDPAALPPEKVSQAAVDELLKRGVVTKGDWVILTKGDSYTAQGGTNTMKVLHVGD
LLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgccgcaccaaaatcgtcgccaccctcggcccagccagcaattccccggaa
gtgctggagcagctgatcctggccgggatcgacgtcgcccgcctcaacttctcccacggc
acccccgatgaacaccgtgcccgcgccaggctggtgcgcgagctggcggccaggcacggc
cgcttcgtcgccctgctcggcgacctgcaaggaccgaagatccgcatcgccaagttcgcc
agcaagcgcatcgaattgcaggtcggcgacaggttccgcttctccaccagccacccgcgc
gacgccggcacccaggaagtggtcggcatcgactatccggacctggtgaaggactgcggt
gtcggcgacgaactgctgctggacgacggccgggtggtgatggtggtcgaggaagtcgcc
gccgacgaactgcgctgccgggtgctgatcggcggcccgctgtccgaccacaagggcatc
aaccgccgcggcggcggtctcaccgcgccggcgctgaccgacaaggacaaggccgacatc
aagctggccgcggacatggacctggactacgtggccgtttccttcccgcgcgacgccaag
gacatggaatacgcccgcagcctgctcaccgaggccggtggcaaggcctggctggtggcc
aagatcgaacgcgccgaagcggtggccgacgacgacgccctcgacggcctgatccgcgcc
agcgacgcggtgatggtggcgcgcggcgacctcggcgtggaaatcggcgatgccgagctg
gtcggcatccagaagaagatcatcctgcacgcccgccgcaacaataaagtggtgatcacc
gcgacccagatgatggagtcgatgatccacagcccgatgccgacccgcgcggaagtctcc
gacgtggccaacgccgtactcgactacaccgacgcggtgatgctctcggcggaaagcgcc
gccggcgaatacccggtggaagcggtgaaagccatggcccgcgtctgccagggcgccgag
aagcacccgaccagccagaagtccagccaccgcctcggccagaccttcgaccgctgcgac
gagagcatcgccctggcgtcgatgtataccgccaaccacttcccggggatcaaggcgatc
atctgcctgaccgaaagcggcttcaccccgctgatcatgtcgcgcatccgctcctcggta
ccgatctacgcctattccccgcaccgcgagacccaggcccgcgtggccatgttccgcggc
gtggagaccatccccttcgacccggccgcgctgccaccggaaaaggtcagccaggccgcg
gtcgacgaactgctcaagcgcggcgtggtgaccaagggcgactgggtgatcctgaccaag
ggcgacagctataccgcccagggcgggaccaacaccatgaaggtcctgcacgtcggcgac
ctgctggtataa

DBGET integrated database retrieval system