KEGG   Pseudomonas aeruginosa PA7: PSPA7_4898Help
Entry
PSPA7_4898        CDS       T00569                                 

Gene name
pyk1
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:pap01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pap01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pap00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pap00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pap00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
5051250..5052701
Genome map
AA seq 483 aa AA seqDB search
MSVRRTKIVATLGPASNSPEVLEQLILAGIDVARLNFSHGTPDEHRARARLVRELAARHG
RFVALLGDLQGPKIRIAKFASKRIELQVGDRFRFSTSHPRDAGTQEVVGIDYPDLVKDCG
VGDELLLDDGRVVMVVEEVAADELRCRVLIGGPLSDHKGINRRGGGLTAPALTDKDKADI
KLAADMDLDYVAVSFPRDAKDMEYARSLLTEAGGKAWLVAKIERAEAVADDDALDGLIRA
SDAVMVARGDLGVEIGDAELVGIQKKIILHARRNNKVVITATQMMESMIHSPMPTRAEVS
DVANAVLDYTDAVMLSAESAAGEYPVEAVKAMARVCQGAEKHPTSQKSSHRLGQTFDRCD
ESIALASMYTANHFPGIKAIICLTESGFTPLIMSRIRSSVPIYAYSPHRETQARVAMFRG
VETIPFDPAALPPEKVSQAAVDELLKRGVVTKGDWVILTKGDSYTAQGGTNTMKVLHVGD
LLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgccgcaccaaaatcgtcgccaccctcggcccagccagcaattccccggaa
gtgctggagcagctgatcctggccgggatcgacgtcgcccgcctcaacttctcccacggc
acccccgatgaacaccgtgcccgcgccaggctggtgcgcgagctggcggccaggcacggc
cgcttcgtcgccctgctcggcgacctgcaaggaccgaagatccgcatcgccaagttcgcc
agcaagcgcatcgaattgcaggtcggcgacaggttccgcttctccaccagccacccgcgc
gacgccggcacccaggaagtggtcggcatcgactatccggacctggtgaaggactgcggt
gtcggcgacgaactgctgctggacgacggccgggtggtgatggtggtcgaggaagtcgcc
gccgacgaactgcgctgccgggtgctgatcggcggcccgctgtccgaccacaagggcatc
aaccgccgcggcggcggtctcaccgcgccggcgctgaccgacaaggacaaggccgacatc
aagctggccgcggacatggacctggactacgtggccgtttccttcccgcgcgacgccaag
gacatggaatacgcccgcagcctgctcaccgaggccggtggcaaggcctggctggtggcc
aagatcgaacgcgccgaagcggtggccgacgacgacgccctcgacggcctgatccgcgcc
agcgacgcggtgatggtggcgcgcggcgacctcggcgtggaaatcggcgatgccgagctg
gtcggcatccagaagaagatcatcctgcacgcccgccgcaacaataaagtggtgatcacc
gcgacccagatgatggagtcgatgatccacagcccgatgccgacccgcgcggaagtctcc
gacgtggccaacgccgtactcgactacaccgacgcggtgatgctctcggcggaaagcgcc
gccggcgaatacccggtggaagcggtgaaagccatggcccgcgtctgccagggcgccgag
aagcacccgaccagccagaagtccagccaccgcctcggccagaccttcgaccgctgcgac
gagagcatcgccctggcgtcgatgtataccgccaaccacttcccggggatcaaggcgatc
atctgcctgaccgaaagcggcttcaccccgctgatcatgtcgcgcatccgctcctcggta
ccgatctacgcctattccccgcaccgcgagacccaggcccgcgtggccatgttccgcggc
gtggagaccatccccttcgacccggccgcgctgccaccggaaaaggtcagccaggccgcg
gtcgacgaactgctcaagcgcggcgtggtgaccaagggcgactgggtgatcctgaccaag
ggcgacagctataccgcccagggcgggaccaacaccatgaaggtcctgcacgtcggcgac
ctgctggtataa

DBGET integrated database retrieval system