KEGG   Pantoea ananatis PA13: PAGR_g0188Help
Entry
PAGR_g0188        CDS       T01970                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paq  Pantoea ananatis PA13
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAGR_g0188
  Energy metabolism
   00680 Methane metabolism
    PAGR_g0188
Enzymes [BR:paq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PAGR_g0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(206124..208772)
Genome map
AA seq 882 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDQVETIRKLSKSSRAGNDTHRKALLNTL
QNLSNDELLPVARAFSQFLNLTNVAEQYQTISRSGDGANHPELLKKTFETLKQNNLSESA
IHAAIESLSLELVLTAHPTEITRRTLIHKLGEVNSCLEQLDHSDISDYERNQIMRRLRQL
VAQAWHTDEIRKYRPTPVDEAKWGFAVVENSLWEGVPAFLRELNEQVEETFGIKLPVDFV
PVQFTSWMGGDRDGNPNVTASITRHVMQLSRWKATDLFLRDIGVLISELSMSECSQEVAD
LSGDPEALEPYRVILKRLRSQLMSTQAYLERRLKGERLPRPADLLVSNAQLWDPLYAIYQ
SLQQCGMSIIANGQLLDTLRRVKCFGVPLVRIDVRQESTRHTEAIAEITRYLGLGDYESW
SEADKQAFLIRELNSKRPLLPRSWEPSDETREVLETCKVVAEAPQGSIAAYVISMAKTPS
DVLAVHLLLKEAGIPFAMPVAPLFETLDDLNNANDVMSKLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYQAQDALIKTCEKAGVSLTLFHGRGGTIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKYGLPEVTIASLSLYTGAILEANLMPPPEPKPEWRSIMNQLS
ADSCAMYRGYVRENADFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAALQQAMLAGHQDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLDADIKAVLTIANDSHLMADQPWIAESIALRNVYTDPLNV
LQAELLHRSRAQEARGDEPDARVEQALMVTIAGVAAGMRNTG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtatgctcggcaaactgctcggg
gatacgattaaggatgcgctgggagagaacatcctggaccaggtggaaaccatccgtaag
ctgtctaaatcatcccgtgctggcaatgacacgcatcgtaaggcgttgctgaatacgctg
cagaacctgtcaaatgacgagttgttgcccgtcgcacgtgctttcagtcagttcctgaac
ctcactaacgtggctgaacagtatcaaaccatttcccgtagcggcgatggcgcgaatcat
cccgagttgttaaaaaagaccttcgaaacgctcaaacaaaacaatcttagtgaaagtgct
attcacgcggcgattgaatccctgtcgctggaactggtgttgaccgcccatcccacagaa
attacgcgtcgtacgctgattcataaactgggcgaagttaacagctgtcttgaacagctc
gatcacagcgatatttctgactacgagcgtaaccagattatgcgccgcctgcgccaactg
gtcgctcaggcctggcatacggatgagatccgtaaataccgtcctacgcccgtggatgaa
gccaaatggggctttgccgtcgttgaaaacagcctgtgggaaggcgtacctgcgtttctg
cgtgagctgaatgaacaggtagaagagacgtttggcattaagctgccggtcgatttcgtt
ccggtgcagtttacctcctggatgggcggtgaccgtgacggcaaccccaatgtcacggcc
tccatcacccgccacgtcatgcaactcagccgctggaaagccaccgacctgttcctgcgt
gacattggcgtactgatttcagaactgtcgatgtctgaatgcagtcaggaagtggccgat
ctcagtggcgatcctgaagcgctcgaaccttatcgcgtgattttgaagcgtctgcgcagc
cagctaatgagcacgcaggcttatctggaacgtcgcctcaaaggcgaacgtttaccacgt
ccggctgacctactggtctctaacgctcagctttgggacccgctgtatgcgatctatcaa
tccctgcagcagtgtggcatgagcatcattgccaacggccaactgctggatacgctgcgc
cgcgtcaaatgcttcggcgtgccgctggtccgcattgatgttcgtcaggaaagcacccgt
cacaccgaagccattgcagagattacccgctaccttgggctgggcgattatgagagctgg
tcagaagccgacaagcaagcgttcctcatccgcgagctgaactctaagcgccctttactg
ccgcgcagctgggaaccgagcgatgaaacccgcgaagtgctggaaacctgcaaagtggta
gcggaagcgcctcagggctctatcgccgcctatgtgatttcgatggcaaaaacgccgtcg
gatgtgctggccgtccacctgttactgaaagaagccggtataccttttgcgatgccggtt
gcaccgctgtttgaaacgcttgatgacctcaacaatgccaacgatgtgatgagcaagttg
ctcaacattgactggtatcgcggctttattcagggcaaacagatggtcatgattggctat
tccgactcggcgaaagatgccggcgtcatggcggccagttgggcgcagtatcaggcgcag
gatgcgctgattaaaacctgcgaaaaagccggagtgtcactgaccttgttccacggacgt
ggcggtactatcggtcgcggcggcgcgccggcacatgctgcgctgctgtctcagccgcca
ggcagcctgaagggcggcctgcgcgttaccgagcagggcgaaatgatccgctttaaatac
ggtttaccggaagtgactatcgccagcctgtcgctctataccggtgcgatactggaagct
aacctgatgccaccgccggaacctaaaccggaatggcgcagtattatgaatcagctttct
gcggattcctgtgcgatgtaccggggctacgtgcgcgaaaacgccgactttgtgccctac
ttccgttcagccaccccagagcaggaactgggcaagctgccactgggttcacgcccggcc
aaacgccgtcctaccggcggtgtggaatccctgcgcgccattccctggatcttcgcctgg
acccaaaaccgtctgatgctcccggcatggctgggtgcaggtgcggcgctgcagcaggcg
atgctggcaggccatcaggatcagctcgaagcgatgtgtcgcgactggccgtttttctca
acccgcctcggtatgctggagatggtgttctctaaagcagacctgtggctggcggaatat
tacgaccaacggctagtggataaatccttgtggccattaggtcaacagctgcgtgaccag
ctggatgccgatatcaaagccgtgctgaccatcgccaacgattcacacctgatggcggat
cagccgtggattgccgaatccattgccctgcgcaacgtgtataccgatcccctgaacgta
ctgcaggctgaactgcttcaccgttcacgtgctcaagaagcccgcggtgacgaaccggat
gcgcgcgtcgaacaggcgctgatggtgacgattgccggtgtcgctgctggcatgcgtaac
acgggttaa

DBGET integrated database retrieval system