KEGG   Pantoea ananatis PA13: PAGR_g0790Help
Entry
PAGR_g0790        CDS       T01970                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase PepM
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00440  Phosphonate and phosphinate metabolism
paq01100  Metabolic pathways
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAGR_g0790
Enzymes [BR:paq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PAGR_g0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AER31326
LinkDB All DBs
Position
833775..834629
Genome map
AA seq 284 aa AA seqDB search
MIKKLIAEKGTLIFIEAHNPLSALIASKAEQTNSEGRIVKFDGIWSSSLTDSASRGIPDN
ETLALSSRLENIADIRNVTDMPIIMDADTGGKPEHFSYYVKRMINNGVNGVIIEDKTGLK
KNSLFGTEVEQTLADINDFSEKIKRGKSAVYIDDFMIIARLESLIAGFDVEHALERADAY
VEAGADGIMIHSCKKTPDEVFLFSTKFRKKYPSVPLICVPTTYSATSNRELSEAGFNVII
YANHMLRAAYKAMENVSKEILRYGRTAEIEKSCMSVKEIISLIP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaacttattgcagaaaagggtactctgatttttattgaggcccataatccg
ctctccgcattaattgcgtctaaagcagaacaaactaattcagaaggccgtattgtcaaa
tttgacggtatatggtcaagctcgttaacggactcagcatctcgcggtattcccgataac
gaaacactggcattaagcagcaggttagaaaatattgctgatatccgaaatgtgacagac
atgcccatcatcatggatgctgatacggggggaaaaccagaacattttagttattacgta
aaaagaatgattaacaacggtgtaaatggcgtcatcatcgaagataaaacaggattaaag
aaaaattctttgttcggcactgaagtagaacagactctcgcagatattaatgatttttca
gagaagattaaaagaggaaaatctgcagtttatattgatgattttatgatcatagccaga
cttgaaagtcttattgcagggttcgacgtagaacatgcactcgaacgtgccgacgcatac
gtcgaagccggggcagacggaattatgattcatagttgtaagaagactccggatgaggtt
ttcttattcagtacgaaatttcggaaaaaatatccatcagtaccattaatttgtgttcct
actacttattctgcaaccagcaacagagaactcagtgaagcgggttttaacgtgatcatt
tatgcaaaccatatgctcagggctgcttataaagcaatggaaaatgtttcaaaagaaata
ttgagatatggcaggacggcagagatagaaaaatcttgcatgagtgtaaaggaaattatt
tcactgattccttaa

DBGET integrated database retrieval system