KEGG   Psychrobacter arcticus: Psyc_1138Help
Entry
Psyc_1138         CDS       T00256                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
par  Psychrobacter arcticus
Pathway
par00620  Pyruvate metabolism
par00680  Methane metabolism
par01100  Metabolic pathways
par01120  Microbial metabolism in diverse environments
par01200  Carbon metabolism
Module
par_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psyc_1138 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Psyc_1138 (ppc)
Enzymes [BR:par01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Psyc_1138 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAZ18989
UniProt: Q4FSL9
LinkDB All DBs
Position
complement(1362462..1365242)
Genome map
AA seq 926 aa AA seqDB search
MTINNHILRERISLLGSFLGDAISRQTGEQTLHTIEILRKGFIQQRREPNEAHKQQLIDF
IASLDNQALKNVIRSFSIYFFLANLSEENYLREQRHTLRMQSEHSWEGSFRRTLLECRER
NIEPAQMQELIEQLKFIPVFTAHPTEARRRTTMNLLQSLFTHSDALNNFAKNSFAYEQAK
EQTAQTIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKDAIVEIYPEL
IDYPLPAFMSFGSWIGGDRDGNPFVTHDTTEMAVLMHADAVLRHYQVLLKKLRRQLIHSD
TIVTIEPDVYAKIESYIELDRRVFDYNLDDYGNEPYRRLLSLILSKVKATNYLIQSKGSD
SEAKKDAYANPQELLEDLRIIRQSVNTHDTAHGEGLLLDVIRLVKTCGFHLAALDIRQES
SYHSGVIADIFANAANLPDYQTLNETERQQWLTRLLEKPGTPLIYTDNLTDKTREQLALM
NSVATLRKLVGQDTFGSYVISMTNNASQLLEVLLLMRFAGLCRVDDKGQLSADLPVAPLF
ETIEDLKNIDKILPAVLDNPLYRGLLQHSDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINRIAEEYGIKTRLFHGRGGSVSRGGGSTHKAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMGITGTLKACSSRFVVQPPELPQYEALFARLADVGEQRYRKLTDHTEGFY
EFYSQATPVAEISLLNIGSRPAHRNKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
DSVKEDEALMKEMNDCWPFFNVFISNIEMAFTKSDMSIAHAYSQLCDDEMLREQIMTAVT
DEHELTYSGLNSLLNQQSLLSSQQNLSASLEWRNAYLDPTNYIQIELLKRARQKEASGDA
NHGDLDVEDPLIRSINALAAGLRNTG
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaataaccacatattacgtgagcgcatcagtttattaggatcatttctaggc
gacgctatttctcgccaaacaggcgaacaaacgctgcatactattgaaatcctgcgcaaa
ggttttatccaacaacgccgtgagcctaatgaagctcataagcagcagctcatcgacttc
attgcttctttagacaatcaagccttaaaaaacgtcatccgcagcttttctatctatttt
ttcttagcaaatttgagtgaagagaattacctgcgtgagcaacgtcatacactacgtatg
caatcagagcacagctgggaaggctcatttcgtcgcaccttactggaatgtcgtgagcgc
aatattgagccggcacaaatgcaagagctcattgagcaactaaaatttatcccagtcttt
acggcacaccctacagaagcgcgtcgccgtacaaccatgaatctattacaaagtctattt
acgcatagtgatgccttaaacaactttgctaaaaacagttttgcctacgagcaagcgaaa
gaacaaacagcgcaaacaattgacttattatggtcgtctgatgaagtgcgtacgcgtaag
cctttagtctatgacgagataaataatggcttacactattttaatgccagtttattcaac
gccattcccaaggtttatcgtaatattaaagacgctattgttgagatttacccagagcta
atagactatcccttacctgcgttcatgagttttggctcttggatcggtggcgacagagat
ggcaatccatttgtcactcatgacaccacagaaatggccgtattgatgcatgcagatgcc
gtattgcgtcactatcaagtgctgctgaagaaactacgtcgccagctcattcatagcgat
acaattgttactatcgagcctgatgtgtatgccaagattgaaagttacattgagctcgac
agacgagtctttgattataatcttgatgattacggtaatgagccttatcgcagattactc
tccttaatccttagtaaggtcaaagccactaactatcttattcaaagtaaaggcagtgat
agtgaagctaaaaaagatgcttacgccaatccacaagagctattagaagacttacgcatc
atccgtcaaagtgtaaatactcatgacacagcacatggcgaaggcttattactcgatgta
attcgcttggtaaaaacctgtggctttcatttggcagcgctcgatattcgccaagaatcc
tcttatcatagtggggtgattgctgatatttttgccaatgccgctaatttgccagactat
caaaccctcaatgaaaccgagcgacaacaatggctgacgcgcttgcttgaaaaaccaggt
acaccgctcatttacactgataatttgacagataaaacccgtgaacaattagccttgatg
aactcagtggccaccttacgtaaattggttgggcaagatacttttggcagttatgtgatt
tcaatgaccaataacgccagtcagttgttagaagtgttgctactaatgcgttttgcaggc
ttatgcagagtcgatgataagggacagctctctgctgacttgccagtagcacccttgttt
gagacgatcgaagatcttaaaaatatcgataaaattctacctgctgttttagataatccg
ctttatcgagggttgttgcagcactcagataacacccaagaaatcatgctaggctattca
gattcatcaaaagatggtggcatcattacttctgcatggcagctttatagcgcgcagcaa
accattaaccgtatcgctgaagaatacggtatcaaaacccgcttattccatggtcgaggt
ggctctgtcagtcgtggtggtgggtcaacgcataaagcgattgctgctcagcccgccggc
acactgcatggacaaatcaaagtgaccgaacaaggcgaagtcctctatgctaaatatgcc
aacactgatacggcggtatttgagctaaccatgggcattactggcacgcttaaagcctgc
tcttcaagattcgtggtgcaaccgcctgagctgccacaatatgaagcactctttgcgcgc
ttagcagatgtaggtgagcagcgttatcgcaagcttactgatcataccgaagggttttat
gagttctactcacaagcaacgccagtggcagaaatctctttattaaatatcggctcacgc
cccgcgcatcgtaataaaggtttaccaagtaaaacgactttgcgagcgattccttgggta
tttggttggtcactagcacgctttacactgcccgcttggtatggtgtcggcagtgcttta
gatagcgtaaaagaagatgaagcattgatgaaggagatgaacgactgctggccgtttttt
aacgtgtttattagcaatattgagatggcttttaccaagtctgatatgagtattgctcat
gcctatagccaattatgtgacgatgagatgttacgtgaacagattatgacagcggtaacg
gatgagcacgagttgacctattcaggcttaaactccttgcttaatcaacaatccttgttg
tctagtcaacaaaatctttcggcttcccttgaatggcggaacgcgtatttggatccgacc
aactatatccaaatagagctgttaaagcgtgccagacaaaaagaggcgtcaggcgatgcc
aaccacggtgaccttgacgttgaggatccattaatccgtagtattaatgccttagcagca
ggtctacgcaatactggttaa

DBGET integrated database retrieval system