KEGG   Paraburkholderia sp. SOS3: BTO02_28705Help
Entry
BTO02_28705       CDS       T04966                                 

Definition
(GenBank) fatty acyl-AMP ligase
Organism
para  Paraburkholderia sp. SOS3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(1924476..1927391)
Genome map
AA seq 971 aa AA seqDB search
MTTLDEPRSTRTADARTTLLDIVRTLADESRAGEANGDAAAPHGSPVQVTLDTQFERDLG
FDSLVRAELLTRIEAAFGTHLPVDAFASARTPADVLGALAGAPEVSAPPSVSTPADAAFA
PFADERIDAPHAAATWSDVIRWHAMRHPDRTHLVIVDEAARETPVSIGALYRQALLAAGG
LRALGIEAGDSVALMLPTGLDYFVCFTALLFCNAIPVPLYPPAHRSELEDHLRRNIAILA
NARAKALIAAGEVSLIARLLAIQAPTLRHVLTPQKIAPQPMPAPLAAHADDIALFQYTSG
STGAPKGVILSHRNLLANIRAMGERMRVTERDVLVSWLPLYHDMGLIGAWLAPLYYGFPL
VVMSPLAFLARPADWLRAIGRHRGSITAAPNFAYERCAHRLAERDLYGVDLSSLRFAFCG
AEPVNPQTMRAFAAQFAAYGLAPNAITPVYGLAENTLGLTFPPPSRGLRVDRIVRTALHE
SGLALAALNGDDFVETVGCGFPLDGTELRIVGNDGEELAQRHVGRIEFRGTSATRGYWRN
APQTEALFDDGWLDTGDLGYVADGELFVTGRVKDMIIRSGRHYFPYELEDTIGRIPGVVH
GGVAVCAGVDKRNGTERVVIIAETTLPAIDTDARSHLKARINAAAITLFGAPAEQVALVR
PRSIIRTPGGKIRHAATLERFESGAHALAPRAFWRQFADAIRPGCAALTHRAMDQVRHVA
RGTVCWSAFAAIATGVFAGIAFRRDEARNWRILARGCRLFLRAAGLRVTVEGDPDALRAS
QVVIVSNHTSYLDVVALVASLPSPVGFVTKRELSRKPFAGPLLRAIGARFVERGVYAGSL
ADETRLIDYAKAGARLLFFPEGTFTHEAGLRAFHLGAFRCACVTGYPVVPIALRGSRLAM
RDGEWIPRQGAIAVTVLPPIAPDGTDFASTARLRERARASILSHCGEPDMAGRLSAPTAS
RIPGSVMTDGL
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgacgagccccgttcgacccggaccgcggacgcacggacaacactgctc
gacatcgtccgcacgctcgccgacgaatcgcgcgcaggcgaggccaatggcgatgcggcg
gcgccgcacggctcacccgttcaggtgacgctcgacacgcagttcgaacgggatctcggt
ttcgacagcctcgtccgcgcggaactgctgacccggatcgaagcggctttcggcacgcat
ctgccggtcgacgcattcgcttcggcgagaacgccagccgatgtgcttggcgcgctcgcc
ggcgcgcccgaggtgtcggcacctccgtcagtcagcacgccggcggatgcggcgttcgcc
ccgttcgcggacgaacgcatcgatgcgccgcacgcggctgccacgtggtccgacgtgatt
cgatggcacgccatgcgtcatccggaccgtacgcatctcgtgatcgtcgacgaagccgcc
cgcgaaacgccggtcagcatcggcgcgctgtaccgccaggccttgcttgccgcaggcggc
ttgcgcgcgctcggtatcgaggccggcgacagcgtcgcgctgatgctgccgacggggctc
gactacttcgtctgctttaccgccctgctcttctgcaacgcgattcccgtaccgctctat
ccgcccgcccatcgcagcgaactcgaagatcatctgcgccgcaatatcgcgatcctcgcc
aatgctcgcgcaaaagcgctgatcgccgccggcgaagtcagcctcatcgcccggctgctc
gcgattcaggcgccgacgctgcgccacgtgttgacgccgcaaaagatcgcgccacagccg
atgccggcgccgcttgcagcgcacgccgacgacattgcgttgttccagtacacgtcgggc
agcaccggcgcgccgaaaggcgtgatcctgagccaccggaacctgctcgcgaacattcgc
gcaatgggcgagcggatgcgcgtcaccgaacgggacgtgctcgtcagctggctgccgctg
taccacgacatgggactgatcggcgcgtggctcgcgccgctttattacggattcccgctc
gtcgtgatgtcgccgctcgcctttctcgcgcggccagccgactggttgcgcgcgatcggc
cgccatcgcggcagcattacggcggcaccgaacttcgcgtatgagcgttgcgcacaccgc
ctcgccgaacgcgatctgtacggggtggatctgtcgtcgctgcgctttgccttttgcggc
gccgaacccgtcaatccgcaaacgatgcgcgcgttcgccgcgcaattcgccgcctatgga
ctcgcgcccaatgcaatcacgcccgtctacggacttgcggaaaatacgcttggcctgacg
tttccgccgccctcgcgcggcctgcgcgtcgaccgtatcgtgcgcacggcgcttcacgaa
tcggggcttgcgttagcggcattgaatggcgacgacttcgtcgaaacggtcgggtgcggg
tttccgctcgacggaaccgaactgcgcatcgtcggcaacgatggcgaggaacttgcgcaa
aggcacgtcggcaggatcgaattccgcggcacgtcggccacgcgcggctactggcgcaat
gcgccgcagaccgaggcgcttttcgatgacggatggctcgatacgggcgacctcggttac
gtcgccgacggcgagctgttcgtgacgggacgcgtgaaggacatgatcattcgcagcggg
cgccattactttccctacgaactcgaagacacgatcggccgcataccgggcgtcgtgcat
ggcggcgtcgccgtctgcgcaggcgtcgacaaacgcaacggcaccgagcgcgtcgtcatc
atcgcggaaacgacgctgcccgccatcgacaccgatgcgcgcagtcatctgaaagcgcgc
atcaatgcggcggctatcacgctgttcggcgcgccggcggagcaggtggcactggtgcgg
ccgcgcagcatcatccgcacgccgggcggcaagatccggcacgcggcgacactcgagcgt
ttcgaaagcggtgcgcatgcgctggcgccgcgtgcgttctggcggcagttcgccgacgcg
atacgccccggttgcgcggcgctcacgcatcgcgcgatggaccaggtgcggcacgtcgca
cgcgggactgtctgctggagcgccttcgccgcgattgcgacgggcgtgttcgccggcatt
gcgtttcgccgcgacgaggcgcgcaactggcgcatcctcgcgcgcgggtgccgcctgttt
ctgcgcgcggcaggcttgcgcgtcacggtcgaaggcgatcccgacgcgctgcgtgcctcg
caggtggtgatcgtatcgaaccatacgagttatctcgacgtcgtcgcgctggtggcgagc
ttgccgtcgccggtcggcttcgtgaccaaacgcgaactgtcgcgcaagccgttcgccggt
ccgctgctgcgcgcgatcggtgcgcgtttcgtcgagcgcggcgtctacgccggcagcctc
gccgacgaaacacgcctgatcgactacgcgaaggccggcgcacgtctgctgttctttcct
gaagggacgtttacgcatgaagcgggcttgcgcgcgttccatctcggcgccttccgctgc
gcatgcgtgaccggatacccggtcgtgccgattgccttacgcggttcgcgcctcgcgatg
cgcgacggcgagtggattccgcgtcaaggcgcgattgccgttaccgtgctgccgccgatc
gcgcctgatggcaccgatttcgcctcgaccgcgcgtctgcgcgaacgcgcgcgcgcgtcg
atcctctcgcactgcggcgaacccgatatggccggtcgcctcagtgcgccgaccgcttcg
cgcatccccggttcggtcatgaccgacggtctgtag

DBGET integrated database retrieval system