KEGG   Paraburkholderia aromaticivorans: CJU94_29345Help
Entry
CJU94_29345       CDS       T05169                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00500  Starch and sucrose metabolism
parb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJU94_29345 (treS)
Enzymes [BR:parb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CJU94_29345 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CJU94_29345 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ASW02214
UniProt: A0A248VT63
LinkDB All DBs
Position
2:complement(2168233..2171697)
Genome map
AA seq 1154 aa AA seqDB search
MKRDDPAQTSSQAHTSAATGGAAKARAHRRGKPAALSDDPLWYKDAIIYQVHIKSFFDAN
NDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIADYRNVHPDYGQIADVKR
FIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNYYVWSNTDQKYQETRIIF
IDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLKEVLQVMRFWLDMGIDGLRLDAV
PYLVEREGTNNENLPETHAVLKKIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDECHM
AFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAETNQWAIFLRNHDELTLEMVTDSERDY
LWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDNI
HLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGSLYGFDAVNVEAQSRDPHSLLNW
TRRMLATRRAKQTFGRGTIRFLKPENRKILAYLREMPGEPPILCVANLSRAPQAVELDLS
EFDGSVPIEMTADSVFPPIGQLTYLLTFPPYGFLWFMLCPGGQRPTWAQAPSEPLPEFVT
IVIREGQVGPTPENVRLLESEVLPSWLSRRRWFASKDQKLNTVRLAALTTIPNGGFAFTE
IEADVGKHTERYVVPIAITWGGETTFPLFKQLALARVRRGRNVGHLTDAFALPIFAHGVM
RKLRERAVVPTVQKSEIRFLPTERFAELEGLGERPEIRWLAAEQSNSSLIIADAAVLKLV
RRLVSGVHPEAEISRYLTQLGYANTAPLYGEVVRVDPEGVPHTLCILQGFIDNQGDAWNW
SLDYLRRSVDELAIAVDTEAQSAPDRANESILMEGYSALAGIIGRRLGELHVALASPTDD
PAFAPEPASAEQVKAWIGGTQAMLASALDLLAPRIAQMTDPETRALAQSLIDRRAALVAA
IDKLVSADAGALRIRIHGDFHLGQVLVAQGDAYLIDFEGEPARTLEERRQKSSPLRDVAG
LMRSLSYASAAAQSTTEAAPQQTADRKRALFDRFRAHAADTFLSEYRAAAAEAPTPLVAP
EAEQALLDLFLIEKAAYEIRYEAANRPTWLSLPIRGLAALTSRLLGDTGTPGHDSSTQAS
GAATPPNPAEGDYE
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgatccagcccaaacctcgtcgcaggctcacacgagcgccgccaccggc
ggcgccgcgaaagcgcgcgcgcatcggcgaggcaagcccgcggccttgagcgacgatccg
ctctggtacaaagacgcgatcatttatcaggtgcacatcaagtcgttcttcgacgcgaat
aacgacggcgtcggcgacttccccggcctgatcgcgaagctcgactacatcgccgagctc
ggcgtgaacgcgatctggctgttgccgttctatccgtcgccacggcgcgacgatggttac
gacatcgccgattaccgcaacgtgcaccccgactacggtcagattgccgacgtgaagcgc
ttcattcaggaagcgcacgcacgcggcattcgcgtgattaccgaactggtgatcaaccac
acgtcggaccagcacccgtggtttcagcgcgcacgccgcgcgaaaccgggttcgaaccat
cgcaactattatgtgtggtccaacacggatcagaagtatcaggaaacgcggatcattttc
atcgactcggagccgtccaactggacgcatgatcccgtggcgggcgcgtattactggcac
cgcttctactcgcaccagcccgatctgaatttcgacaatccggccgtgctcaaggaggtg
ctgcaggtcatgcgcttctggctcgatatgggcatcgacgggctgcggctcgacgcggtg
ccgtatctggtggaacgtgaaggcacgaacaacgagaacctgccggaaacgcacgcggtg
ctcaagaagatccgcgccaccatcgacgccgaatatccgaaccggatgctgctcgccgag
gccaaccagtggccggaagacgtgaaggaatatttcggcgacgaagacgaatgccacatg
gccttccacttcccgctgatgccgcgcatctacatgtcgattgcgagcgaagaccgcttc
ccgatcaccgacatcatgcggcaaacgccggacctcgccgaaacgaaccagtgggcgatt
ttcctgcgcaatcacgacgaactgacgctggaaatggtcacggattcggagcgcgactac
ctgtggaacacctacgcgagcgatcgccgcgcgcgcctgaacctcggcattcgccgccgc
ctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaattcgctgctgctc
tccatgcccggcacgcccgtgatctattacggcgacgaactcggcatgggcgacaacatt
cacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggatcgcaacggc
ggtttttcacgcgccgaccccgagcaactggtgctgccgccggtcatgggctcgctgtat
ggcttcgacgcggtcaatgtggaagcgcaaagccgcgacccgcattcgctgctgaactgg
acgcggcgcatgcttgccacgcgtcgcgcgaagcagactttcggacgcggcacgatccgt
ttcctgaagccggaaaaccgcaagattctcgcgtatctgcgcgagatgccgggcgagccg
ccgattctctgcgtggcgaacctctcgcgtgcgccgcaagcggtggaactcgatctgtcc
gaattcgacggttccgtgccgatcgaaatgacggcggactccgtgtttccgccgatcggc
caactgacctatctgctgacgttcccgccgtatggcttcctgtggttcatgctgtgtccc
ggtggtcagcgtcctacctgggcgcaagcgccttcggaaccgctgccggagttcgtcacg
atcgtgattcgcgaaggccaggtcggtccgacgccggagaacgtgcgcttgctcgaatcg
gaagtgctgccttcatggctgagccggcgccgctggtttgcatcgaaggatcagaagctc
aatacggtgcggctcgcggcgttgaccacgattccgaacggcggttttgcgtttaccgaa
atcgaagcggacgtgggcaagcataccgagcgctacgtggtgccgatcgcgattacgtgg
gggggcgaaaccaccttcccgctattcaagcaactggcattggcacgcgtgcgacgcggc
cgcaacgtcggtcatctgacggacgcgttcgctttgccgatcttcgctcatggcgtcatg
cgcaagctgcgcgaacgcgccgtggtgccgaccgtgcagaagagcgaaatcaggttcctg
ccgaccgaacgtttcgccgaactcgaaggactcggcgagcgcccggagatccgctggctc
gcggcggagcagagcaacagttcgctgatcatcgccgacgccgccgtgctgaagctggtg
cgccgccttgtgagcggcgttcatcccgaagccgagatcagccgctacctgacgcagttg
ggctacgcgaacaccgcgccgctgtatggcgaagtggtgcgcgtcgatccggaaggcgtg
ccgcatacgctctgtatcctgcaaggcttcatcgacaatcagggcgacgcctggaactgg
tcgctcgactatctgcgccgctcggtggacgaactcgccatcgccgtcgataccgaggcg
cagtcggcgccggaccgcgccaacgaatcgatcctgatggagggttacagcgcgttggcc
ggcattatcggcagaaggctgggcgaactgcacgtggcgctcgcgtcgccgacggacgac
ccggcgttcgcgccggagcccgccagcgcggagcaggtgaaggcatggatcggcggcacg
caggcgatgcttgccagcgcgctggatctgctcgcaccgcgcatcgcgcagatgaccgat
ccggaaaccagggcgctggcgcaaagcctgatcgaccgccgtgcggcgttggtcgccgcc
atcgacaagctggtttccgccgacgcgggcgcgctgcgcattcgcattcacggcgacttc
catctcggccaggtgctggtcgcgcagggcgacgcgtatctgatcgatttcgaaggcgag
ccggcacgcacgctcgaagagcgtcgtcagaagtcgagcccgttgcgtgacgtggccggt
ctgatgcgctcgctgtcgtatgcgagcgcggcggcacagtccaccacggaagccgcgccg
caacagaccgccgaccgcaagcgcgcgctgttcgaccggttccgcgcgcatgccgccgac
acgttcctcagcgagtaccgtgcggccgccgctgaagcgccgacgccgctcgtcgcgccc
gaagccgagcaggctttgctcgatctgttcctgatcgaaaaagccgcctacgaaatccgt
tacgaagcggccaaccggccgacgtggctcagcttgccaatccgcggcctcgccgcgctc
acgagccgtttgctcggagacaccggcacgccaggtcacgattcctcaacccaggcgtca
ggcgccgccacaccgcctaatccggccgagggcgactatgagtga

DBGET integrated database retrieval system