KEGG   Paracoccus sp. BM15: CUV01_04935Help
Entry
CUV01_04935       CDS       T05237                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paro  Paracoccus sp. BM15
Brite
Enzymes [BR:paro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CUV01_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 NADH_u_ox_C
Motif
Other DBs
NCBI-ProteinID: AUH32812
UniProt: A0A2K9EXK6
LinkDB All DBs
Position
985021..985647
Genome map
AA seq 208 aa AA seqDB search
MIDLYTWTTPNGRKISILLEELGLPYAVHAVDIGKEQQFDPDFLKVSPNNKIPAIVDDGL
AVFESGAIMIHLAEREGRFLPTDPKARADVMQWLMWQMGGFGPMLGQAHVFIKNNKGLAP
AAEERFAKEALRLYGVLDRQLEGQDFVAGDYSIADMAIFPWAARHDWHEVDLRQFPNVLR
WYRALAERPAVQKGYQVPKDVGPIPMPE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttacacctggaccacgccgaacgggcgcaagatttccatcctgttggaa
gagctggggctgccctatgccgtgcacgccgtcgatatcggcaaggaacagcaattcgac
ccggatttcctgaaggtctcgcccaataacaagatcccggcgattgtggatgacgggttg
gccgtctttgaatccggcgcgatcatgatccatctggccgaacgcgagggacgctttttg
ccgaccgaccccaaggcgcgtgcggatgtgatgcaatggctgatgtggcaaatgggcggc
tttggcccgatgctgggccaggcgcatgtctttatcaagaacaataaggggctggccccc
gccgccgaagaacgcttcgccaaagaggcactgcggctttacggcgtgctggaccgccag
cttgaggggcaggatttcgtcgcaggcgactattccatcgccgacatggcgatctttccc
tgggcggcacggcatgattggcatgaggtcgatctgcgccagttcccgaatgtgctgcgc
tggtatcgtgcgctggccgaacgtccggcggtgcaaaaggggtatcaggtgccaaaggat
gtcggcccgatcccgatgccggaatag

DBGET integrated database retrieval system