KEGG   Pseudoalteromonas atlantica: Patl_2859Help
Entry
Patl_2859         CDS       T00372                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Patl_2859
Enzymes [BR:pat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Patl_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3466633..3468618
Genome map
AA seq 661 aa AA seqDB search
MKTSLKTIACALAVNFSTQSSAAPTTFVHLFEWNWQDIATECETFLGPKGYAAVQVSPPN
EHITAQQWWARYQPVSYVLQSRGGNRAQFIDMVQRCDSAGVDIYVDAVINHMAAGLGNGT
AGSSFGAKQYPIFSPQDFHTTCTINNYSDRGQVQNCELVGLADLDTDAPYVQDTIAAYLS
DLTNIGVKGFRLDAAKHMPSADISSILSKVAGNPLIFQEVIDQGGEAVSASEYASNGLVT
EFKYSVEIGNTFRNGKLAWLSNFGEDWGFMPSYQAVVFVDNHDNQRGHGGGGNVITFEDG
RLYDLANVFMLAYPYGYPKVMSSFDFHSDTDAGAPNMRVHNNGNLECFGQNWKCEHRWSY
IAGAVDFRNNTHDDFSLSDWWDNGANQIAFGRSSSGFVAINKESYQLNASVSTSMAPGQY
CNVLKGQLTSDAQSCSGEVVTVQNDGTINLSVVPFDAIAIHHNAKITDSAPTQNSQRTVI
FIKAQTQNGQDMFVRGGIDHAYASSQLGKACTAENYQCAIPITHNNLRNTTTAVWKQNEQ
YLDWYGAESAQNAAAQGTAMDWTTNLWPDSYGPHKTVVNDGFGQEVLNAWGEHYWMLDVQ
MDCSKTVNGWFELKAYVKNGQGFEGDVQQIGTPYPSSNHFAQCGKINRFEFNSSTAYIVP
F
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatctttaaaaaccattgcttgtgcactggcagttaattttagcactcaaagc
agtgcagcccccacaacttttgtccacttatttgagtggaattggcaagacatagccacc
gaatgcgaaacctttctgggccccaaaggctatgccgcggttcaagtatcgccaccaaac
gagcacatcaccgcacagcagtggtgggctcgttatcaacccgttagctacgtgttgcaa
agcagagggggaaaccgcgcgcagttcattgacatggtgcaacgctgtgattcagcaggc
gtagatatttacgtagacgcggtcattaaccatatggcggcaggcttaggaaatggaact
gctggcagcagttttggcgccaagcagtaccctatattttccccccaagacttccataca
acctgcacaatcaataactacagtgaccgaggacaggtacaaaattgtgaattggttggc
ctagctgatttagacacggacgcgccttacgttcaagacaccatcgccgcctacttaagt
gacttgaccaacataggcgttaaagggtttagattagatgccgcgaagcatatgcctagt
gccgatatatccagtatattatccaaagtcgcgggcaatcccttgatatttcaagaggtc
atcgatcaaggcggggaagctgtatcagccagtgagtatgccagtaatggcttagtcacc
gagtttaagtacagcgttgaaataggtaacacctttcgaaatggtaaattagcgtggcta
agtaattttggagaagactgggggttcatgcctagctaccaagcagtggtctttgttgac
aaccatgataatcagcggggtcacggcggcggtggcaacgttattacgtttgaagatggc
aggttatacgatctcgcaaatgtgtttatgcttgcctatccctatggatatccaaaggtc
atgtccagctttgactttcattctgataccgatgcaggtgcgcccaatatgcgcgtacac
aataacggtaatcttgaatgctttgggcaaaactggaagtgcgaacatcgctggagttac
attgctggtgcggtagattttcgaaataatacccatgacgatttctcactgtccgactgg
tgggataatggtgctaatcaaatcgccttcggccgcagcagctcaggctttgtagccatc
aataaagagagctatcaacttaacgcaagcgtatccacttcaatggcaccaggacaatac
tgcaatgtactgaaaggtcaacttaccagtgatgctcaaagctgttccggggaggttgta
accgtacaaaacgacggaaccataaaccttagcgtggttccttttgatgcgatagcgatt
catcacaatgcaaaaatcacagactctgcccctactcaaaatagccaaagaacggtcata
ttcattaaagcacagacgcaaaatggtcaggatatgttcgtgcgcggcggtatagaccat
gcctatgccagcagccaattaggcaaggcctgcacggcagaaaactatcaatgtgcaatt
ccaatcacccacaataatctgcgcaacacaaccacggcggtgtggaaacagaatgaacaa
tacctagattggtatggtgctgaaagcgcgcaaaatgcagccgcacaaggcaccgcaatg
gactggacgacaaacctttggcccgacagctatggcccacacaaaacagtggtcaacgac
gggtttggacaagaagtactcaatgcgtggggggagcattactggatgctggatgtacaa
atggattgcagtaaaaccgtaaacggctggttcgaactcaaggcctatgtaaaaaacgga
caaggctttgaaggcgacgtgcagcaaatcggtacaccttatccttcgagcaatcatttc
gctcaatgcggtaagataaaccgattcgaattcaacagttcaactgcgtatatcgtgccg
ttttag

DBGET integrated database retrieval system