KEGG   Pectobacterium atrosepticum 21A: GZ59_05030Help
Entry
GZ59_05030        CDS       T03293                                 

Gene name
fom1
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pato00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    GZ59_05030 (fom1)
Enzymes [BR:pato01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     GZ59_05030 (fom1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
554340..555272
Genome map
AA seq 310 aa AA seqDB search
MSIILPTHTPMDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVTTRPLIFDGDTGGQTEHLA
HHIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILTFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDKCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctacccacaccccaatggattcatataaggggtgtacgccaggt
tcacgccgcagtgcgcttcgcgaattattacaacagcaaaaaggcattcgcgtgatggag
gctcacagcccactctctgccttattaatagaacaagccgcttatgaagatggcgatatt
cattatcaatttgatgcattctggtctagttcactcactgattctaccttgcggggaaaa
cccgatacggaattggtagatatcagccatcgtttccatgcgattacggaaatatttgat
gttaccacccgaccattaatttttgatggcgatactggtgggcaaactgaacatttggct
caccacattcgggctgctgaaaatctgggcatttccgccatgattatcgaagataaaact
ggcctgaagaagaactctttatttggtaacgatgtaaagcaaacgcaggcttccgtagcg
gatttttgcgaaaaaattacgacggctaaaaaagcacagctgacgcccgagtttatgctg
attgcgcgtattgagagcctgattctggacgtcggtatggaagatgcaataaaccgcgcc
ctgcattatgcagatgctggtgccgatggcattatgatccacagtcggcataagaatcct
tctgagattttaacgttcgccaaacaattccgcgatcattacccacatttacctttggtt
tgtgtccctaccagttttaacgacattactttcgatcaacttattgatggcgggttcaat
atcgttatttatgcaaaccatatgttacgtgcggcttatccggcaatgaaatccattttg
ccagaaatcctcaagcatggtcgaacgctggaagttgaggataaatgcatgtcgataaaa
gatattctggaccttataccaggaacgcgctaa

DBGET integrated database retrieval system