KEGG   Pectobacterium atrosepticum JG10-08: EV46_02520Help
Entry
EV46_02520        CDS       T03199                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:patr00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    EV46_02520
Enzymes [BR:patr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     EV46_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
559331..560263
Genome map
AA seq 310 aa AA seqDB search
MSIILPTHTPMDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVTTRPLIFDGDTGGQTEHLA
HHIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILTFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDKCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctacccacaccccaatggattcatataaggggtgtacgccaggt
tcacgccgcagtgcgcttcgcgaattattacaacagcaaaaaggcattcgcgtgatggag
gctcacagcccactctctgccttattaatagaacaagccgcttatgaagatggcgatatt
cattatcaatttgatgcattctggtctagttcactcactgattctaccttgcggggaaaa
cccgatacggaattggtagatatcagccatcgtttccatgcgattacggaaatatttgat
gttaccacccgaccattaatttttgatggcgatactggtgggcaaactgaacatttggct
caccacattcgggctgctgaaaatctgggcatttccgccatgattatcgaagataaaact
ggcctgaagaagaactctttatttggtaacgatgtaaagcaaacgcaggcttccgtagcg
gatttttgcgaaaaaattacgacggctaaaaaagcacagctgacgcccgagtttatgctg
attgcgcgtattgagagcctgattctggacgtcggtatggaagatgcaataaaccgcgcc
ctgcattatgcagatgctggtgccgatggcattatgatccacagtcggcataagaatcct
tctgagattttaacgttcgccaaacaattccgcgatcattacccacatttacctttggtt
tgtgtccctaccagttttaacgacattactttcgatcaacttattgatggcgggttcaat
atcgttatttatgcaaaccatatgttacgtgcggcttatccggcaatgaaatccattttg
ccagaaatcctcaagcatggtcgaacgctggaagttgaggataaatgcatgtcgataaaa
gatattctggaccttataccaggaacgcgctaa

DBGET integrated database retrieval system