KEGG   Pectobacterium atrosepticum JG10-08: EV46_09875Help
Entry
EV46_09875        CDS       T03199                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00250  Alanine, aspartate and glutamate metabolism
patr00410  beta-Alanine metabolism
patr00640  Propanoate metabolism
patr00650  Butanoate metabolism
patr01100  Metabolic pathways
patr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:patr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EV46_09875
   00650 Butanoate metabolism
    EV46_09875
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EV46_09875
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EV46_09875
Enzymes [BR:patr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EV46_09875
Amino acid related enzymes [BR:patr01007]
 Aminotransferase (transaminase)
  Class III
   EV46_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIA70885
LinkDB All DBs
Position
2255849..2257114
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRLAATPRGVGVMCDFYAERAENSTLWDVEGREFIDFAAGIAVLNTGHRHPK
IVAAVREQLDRFTHTAYQIVPYGSYVTLAERINALAPIQGAAKTTFFTTGAEAVENAVKI
ARAYTKRPGVIAFNAAFHGRTLLTMTLTGKVAPYSTGFGPFPGSIFHALYPNEQTGITVE
QALESVERLMHTDIAADQVAAIILEPVQGEGGFHVAPPAFISGLRKLCDEHGILLIADEV
QTGFARTGKLFAMEYYTEKADLITMAKSLGGGFPISGVVGRAEVMDAPSPGGLGGTYAGN
PLSVASALAVLDVIEEEKLCQRAQRLGAALVETLEKVKAQCPALVAIRAQGSMVAAEFND
PNTGKPSAEITRQFQKSALEAGLLLLTCGVHGNVIRFLYPLTVPDEQFSKAMNILTRVLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagcgaactgaatcaacgccgtctggccgccacaccgcgtggtgtaggtgtc
atgtgtgatttctatgctgagagagcggaaaacagcaccctgtgggatgttgaaggacgc
gagtttatcgatttcgccgccgggattgcggtgctgaataccggccatcgccacccgaaa
attgtcgctgcggtgcgcgaacaactggatcgctttacccatacggcctatcaaattgtg
ccttacggtagctatgtcacgttggccgagcgtattaatgcgttggcaccgattcaaggc
gcggcaaaaaccacgttctttaccaccggagcagaagcggtggaaaacgcggtgaaaatc
gcccgtgcttacaccaagcgtcctggcgtgattgctttcaacgcggcgtttcatggtcgt
acactgctgaccatgacgctgacgggcaaagtagcaccgtactccacggggtttggcccg
ttccccggttccatttttcacgcgctttatccgaatgaacaaaccggtattaccgttgaa
caggcactggaaagcgtcgaacgtctgatgcataccgatatcgccgccgatcaggttgct
gcgattattctggaaccggtacagggtgaaggcggttttcatgttgcgccgcccgctttt
atcagcgggctgcgtaagctgtgcgatgagcatggcatcctgctgattgccgatgaagtg
cagacgggctttgcgcgtaccggtaagctgtttgcgatggagtattacacggagaaagcg
gatctgatcaccatggcgaaaagcctgggcggtggtttcccgatctctggcgtggtcggc
cgtgctgaggtgatggatgcgccatcgccgggcgggctgggcggcacctatgcgggtaac
ccgctgtcggtcgcttcggcgctggcggtattggatgtgattgaagaagaaaaattgtgc
caacgtgcgcagcgtctgggtgctgcactggtagaaacgctggagaaagtaaaagcgcag
tgtccagcactggtagcgattcgtgcgcaagggtcgatggtcgcggctgaatttaacgat
ccgaacacgggtaaaccctcggcagagattacccgccaatttcagaaaagcgcattagag
gcgggcttgctgctgctgacctgcggtgtgcatggcaacgtgattcgtttcctgtatccg
ctgacggttcctgatgagcagttcagcaaagcgatgaacatcctgacgcgcgtattaaca
cgatag

DBGET integrated database retrieval system