KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_33280Help
Entry
PA14_33280        CDS       T00401                                 

Gene name
pvdL
Definition
(GenBank) PvdL
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABJ11607
UniProt: A0A0H2ZA98
LinkDB All DBs
Position
2912099..2925127
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALERLDLSGWRVAFSGSEP
IRQDSLERFAEKFAASRFEASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGAGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNPEASAKT
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQEAQPPAGDDELLARIGEIWRARLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGL
PAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGAALQRIDEQGEFAWQFVDLAALAEHERDAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDAAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFEEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAARLAEWGSAPCEPARAWLPELLERQLAQ
SAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPV
SFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSTDG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAAGAEAEAEQNQRLRAALQAELPEYMVPAQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGTIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVGGVPVQRVHSD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRGHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVARWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIERFGMRADDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTG
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
QVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAE
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLARREHWNQSLLLQPRQ
AIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLVVDGVSWRVLLEDLQQVYRQFAEG
AEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQPVEWPCDRPQGDNREALA
ESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDAQTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYGALGEGRPANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAP
TVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDPGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCVDRPRLL
VWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAIAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQEGANGKYLVGYLVPGETPRSSADSPAGLMVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLDRMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttcccaccaccctggtccaggccctgcgtcgccgcgccgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctatcgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgatcgcgcggtgctgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggttgcctgtatgccggggtcatcgcggtgccggcctatccgccggagtcggcg
cgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcgcaactgtccgccgcc
aacgccccgcaactgctctgcgtcgaccagttggacccggccgttgccgaggcctgggac
gagccgcaagtgcgtcccgagcacatcgccttcctccagtacacctccggttcaaccgca
ctgcccaagggcgtgcaggtcagccatggcaacctggtcgccaacgaggtgttgatccgc
cgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgtccggtgcgctggctggaagccatcagccagtacggc
ggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagcgagcgggtcgccgag
tcggccctggagcgtctcgacctgagcggctggcgggtagccttctccggttccgagccg
atccgccaggacagcctggaacgcttcgccgagaaattcgccgccagccgcttcgaggcg
tccagtttcttcgcctgctacggcctcgccgaggcgaccctgttcgtcaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgcaggcagcgtgctgatgtgctgcggccgcagccagccggaacacgccgtg
ctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaacgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcctcggcgaagacc
ttcgtcgagcgtgacgggcgtacctggctgcgcaccggcgacctcggtttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccgcggccacaacctc
tatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcggcgcgcaagggcagg
gtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggcattgccgccgagatc
ggacgcggcgtccagaaatcggtgccggcccaggagctgatcgactcgatccgccaggcg
gtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaagacatccagcggcaagctgcaacgttccgcctgccgcctgcgcctggaagacggc
agcctggacagctatgcgctgtttcccggcctccaggccgtgcaggaagcgcagccgccg
gcaggcgacgacgaactgctggcacgcatcggcgagatctggagggcccggctgggcgtg
gcgcaggtagcgccgcgcgatcacttcttcctgctcggtggcaactccatcggcgccgcc
caggtggtcgcccaggtgcgcgacagtctcggcgtcgccctcgacctgcgccaactgttc
gaggcgccgaccctgcaggccttcagcgccacggtggcccgccaactggccgccggcctg
ccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgacccgcagagcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaggcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgcgacggcgcagccttg
cagcgtatcgacgagcagggcgagttcgcctggcagttcgtcgacctcgccgcgctggcc
gagcacgaacgtgacgcggctgccgcgcagcgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctggacgaacaggagcac
cagctctgggtcaccctgcatcacatcgtcgccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggtggccagccggccgacctggcgccg
ctggaactgcactacgccgaattcgccgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggaacgcctgggcgacgcggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgccggccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggccatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcagcctgcggccagggcggccagttgttccaggtgttgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcctggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaacttcgactacgccgcggacctcttcgaggaggccagtatccgg
cgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcgcctcgccgaatggggcagc
gcgccctgcgagccggcgcgcgcctggctgccggagctgctggagcggcaactggcgcag
tccgccgaacgcgtcgccctggagtgggacggcggcagcctcggctacgccgaactgcac
gcccgggccaaccgcctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctgctggcgatcgtcaag
gcgggcggcgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagcggcgtcgagctgctgctgacccaggcccatctgttcgagcgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacaactggccgagc
caggcaccgggcctgcacctgcacggcgacaatctcgcctacgtcatctacacctccggt
tccaccggccagccgaagggcgtgggcaatacccacgcggcgctggccgagcgcctgcaa
tggatgcaggccacctacgccctcgacggcgacgacgtgctgatgcagaaggcgccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctggtcactggttgccggctggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
ggggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggc
gtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgaggcgcttccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccactggcaatgccgcgcggaagacggcgagcgttcg
ccgatcggccggccgctgggcaacgtggtctgccgcgtgctggacgccgagttcaacctg
ctgccggccggcgtcgccggcgagctgtgcatcggcggcctgggcctggcccgtggctac
ctggggcgcccggcgctgagcgccgagcgcttcgtcgccgatccgttctcgaccgacggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggccgcctcgaccagcaggtcaagctgcgtggcttccgcatcgagccggaggagatc
caggcacgcctgctggcgcagccgggggtggcccaggcggtggtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgccggcgccgaggcggaagcc
gagcagaaccagcgtctgcgcgccgcgctacaggccgaactgccggaatacatggttccg
gcgcagttgatgcgcctggcgcagatgcccctcggcccgagcggcaagctggatacgcgg
gcgctgccggagccggtctggcagcagcgcgagcacgtcgagccgcggaccgagctgcaa
cggcgcatcgccgcgatctggagcgaagtgctcggcctgccgcgggtcggcctgcgcgac
gatttcttcgaactcggcgggcattccctgctggccacccgcatcgtctcgcgcacccgc
caggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggccagcgaactggaggcc
ttctgcgaacaggtccgcgcagcccaggccgccgggcgtaccgacagccacggcacgatc
cgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctataacgtcggcggcctggcgcgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcggcggcgtgccggtacagcgcgtacatagcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagtcgccagcag
cacctgcagaccctcgccgacagcgaggcgcaccgtcccttcgaccttgagagcgggccg
ttgctgcgggtctgcatggtgaagatggccgagcgcgagcactacctggtggtgaccctg
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgaactgggcgcgctc
tacgaggccttcctcgacgaccgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggagagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccagggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcgccgcttcaacgccgcccgcggactgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgcatcggcgcg
ccggtggcgaaccgcatccgcccggagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacggacagatgagcgtcggtgagctgctggagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcaaccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgagcgaccaagttcgacctcaacctggaggtcaccgacctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcatcgcgcggatg
gccggacactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgcattgcc
gaattgccgctgttcgccgccgaggagcggaagcaactgctgctcgccggcacggctggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgtgtggcggccagcccc
caggccccggcgctgaccttcgccggacagaccctgagctatgccgaactcgacgcccgc
tccaaccgcctggcgcgcgtcctgcgcggtcatggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggaatatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgttcgaggccctcggcgagcta
ccggcgggcgtggcgcgctggtgcctcgaggaggacggcccggcgctggacgccgaggac
cccgcgccgctggcagcgctgagcgggccgcagcaccaggcctacctgatctatacctcc
ggctccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagcgcttcggcatgcgcgccgacgattgtgaactgcacttttattcg
atcaacttcgacgccgccagcgagcgcctgctggccccgttgctgtgcggcgcccgcgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcaccccgagctacggcagccagctcgcccagtggctggag
agccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaagcgctgaccggc
gagcacctgcaacggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgaaacggtggtcatgccgctggcctgcctggctcccgaacgactggaggagggt
gccgccagcgtgccgatcggcagcgtggtcggcgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgaactctacgtcggcggcgccggcctg
gcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgcctgtgcgacaacggc
caggtggaatatgtcggccgcatcgaccaccaggtgaagatccgtggcttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgag
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcacctcaagcagcaa
ttgccggactacatggtgccggcccacctgctgttgctcgccagcctgccgctgaccgcc
aacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcgctcaaccggcaggcc
tacgaggccccgcgcagcgtgctggagcagcaactggccggggtctggcgcgaggtgctg
aacgtcgagcgggtaggtctcggcgacaacttcttcgaactgggcggcgattcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccacttcagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggcgcgccgcgaacactggaaccagtcgctgctgttgcagccgcggcag
gccattgacctcggcctgctgcgcaagtccctgcaacgcctggtcgaacagcatgatgcc
ctgcgcctggcgttccgccaggtcgacggcgaatggctggcgcagcatcgtccgctgcgc
gaacaggaactgctctggcacgttccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacaggggccgctgctgcgcgcggtgctggtg
gacggcccggccggcgagcaacgcctgctgctggcgatccaccacctggtggtggacggg
gtgtcctggcgggtgctgctggaggacctgcaacaggtctaccgtcagttcgccgagggc
gccgaaccggcgctgccggccaagaccagcgccttccgcgactgggccggacgcctgcag
gcctacgccggcagcgaatcgctgcgcgaggagctgggctggtggcaagcccggctgggt
gggcagccggtcgagtggccgtgcgaccgcccgcagggcgacaaccgcgaggcgctggcg
gaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccgtcgacgctggtgcagttggaagggcatggccgcgaggcgctg
ttcgacgatatcgacctgacccgcagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgccgacggcgccgatcaccttcaactacctcggacagttcgac
cagagcttcgccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggtgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcagacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccctg
gcggtgccggccggcgagatcgaggacgtctacccgctgaccccgatgcaggaagggttg
ctgttacacaccctgctggaaccgggcaccggcatctactacatgcaggaccgctaccgg
atcgacagcccgctcgatcccgagcgcttcgccgccgcctggcaggcggtggtggcccgc
cacgaggcgctgcgcgcgtcgttcgtctggaatgccggcgaaacgatgttgcaggtgatc
cacaagcctggtcgcacccgcatcgagttcctcgactggagcgagctgccggaggacggc
cacgaggagcgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgacctgctc
gaacagccgccgttccacctgcgcctgatccgcctgggtgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatcgatgcctggtgccgtggcctgctgatgaacgacttc
ttcgagatctacggcgccctcggcgaaggccgcccggcgaacctgccgacgccgccgcgc
taccgcgactacatcgcctggctgcaacgccaggacctggagcaatcgcgccgctggtgg
agcgagagcctgcgcggcttcgagcggccgaccctggtacccagcgaccgaccgttcctc
cgcgagcacgccggcgagagcggcgggatgatcgtcggcgaccgctacacgcgcctggac
gccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccagctcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctg
ttcggcgtcaccgtggccgggcgtccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcagatgccggccgccggccagcgctgcacg
gtgcgcgaatggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtggccatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgccccggtggaagtctcggtgctggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgttgaccgtggtctgc
tatccgggcgatgacctcggcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accgtcgagcgcctgctcggcgagttcaagcgcctgctgctggccctggccgacggtttc
cacggcgaactggaggccttgccgctgctcggcgaggacgagcgcgacttcctcctcgac
ggctgcaaccgcagcgcccgcgactacccgctggagcaaggctacgtgcggctgttcgag
gcgcaggtggcggcccatccgcagcgcatcgccgccagttgcctggagcagcgctggagc
tacgccgagctgaaccgccgggccaaccgcctcggtcacgccctgcgcgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccccggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacgccggtgctggtctgcacccaggcctgc
cgcgagcaggcgctggcgctgttcgacgaactcggctgcgtcgaccggccgcgcctgctg
gtgtgggacgagatccagcagggcgagggcgccgagcacgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttccttgccgcgccgttgttcggcgcccgcgtggcgattgtaccgaacgctatcgcccac
gatccgcagggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcgctgatccagggcatgctcgccgaagagcgccaggccctcgacggcctgcgctgg
atgttgcccaccggcgaggcgatgccgccggaactggcgcgccagtggctcaagcgctac
ccacggatcggcctggtgaatgcctacgggccggcggagtgttccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggtgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggccgtggctacgtcggcgac
ccgctgcgcaccgcccaggccttcgtcccgcatccgttcggcgcgccgggcgagcgcctg
taccgtaccggcgacctggcgcggcggcgcgccgacggagtgctggaatatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtccaggaaggggcgaacggc
aagtacctggtgggctacctggttcccggcgagacaccgcgttccagcgccgactcgccg
gccggactgatggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggaccggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggacatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcacggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggcgggcattcg
ctgctggccacccagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcaccacggtggaagagctggccagctacatcgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system