KEGG   Prunus avium (sweet cherry): 110755298Help
Entry
110755298         CDS       T05161                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi03030  DNA replication
pavi03410  Base excision repair
pavi03420  Nucleotide excision repair
pavi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pavi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    110755298
   03410 Base excision repair
    110755298
   03420 Nucleotide excision repair
    110755298
   03430 Mismatch repair
    110755298
Enzymes [BR:pavi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110755298
    6.5.1.6  DNA ligase (ATP or NAD+)
     110755298
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110755298
DNA replication proteins [BR:pavi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110755298
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110755298
DNA repair and recombination proteins [BR:pavi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110755298
   NER (nucleotide excision repair)
    Other NER factors
     110755298
   MMR (mismatch exicision repair)
    Other MMR factors
     110755298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 110755298
NCBI-ProteinID: XP_021812172
LinkDB All DBs
Position
Unknown
AA seq 789 aa AA seqDB search
MLSRSLCSCYCLRPRSLHHLSTSISVFRSKPSSLSLTLISLSPKNPNLRAMSSRPSAFDA
LMSGARAAAAKKKPQASPPKKRKTLEPNPIENPQLLLKPENGSPTQAPESKEVKEALESS
SNGGQVVPPAKKVCAAAGAQERTAELKNRIALLKKKAGEFDPKLMANWGEGERVPFAFVC
LAFDLIANETGRIVITDIVCNMLRTVMHTTPEDLVPVVYLAANRIAPAHEGLELGIGDAS
IIKALAEACGRTEAHVKKQYKELGDLGLVAKASRSSQSMMRKPDSLTVTKVFSTFRQLAK
ESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGQAAVHTEKH
STPPSHIQSPIDEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPKTCSFTLGVPVGPMLA
KPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMEDGSVEIYSRNAERNTGKFPDVVVAV
SRLKKSSVTSFVLDCELVAYDRVKQKILPFQVLSTRARKNVAMSDIKVDVCIFAFDMLYL
NGQPLIQEQLKVRRESLYDSFVEEAGFFQFATAITSNDIEEIQKFLDAAVDSSSEGLIIK
TLNKDATYEPSKRSLNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDS
NNEEFQSICKIGTGFSEAMLEERSASLRTKVIPKPKSYYRYAETMNPDVWFDASEVWEVK
AADLTISPVHRAAVGIVDPNKGISLRFPRLVRVREDKPPEQASSSAQVAEMYSAQANTRS
NNQDDNEDD
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgatcactgtgttcatgctattgtctacgcccacgctctctccaccatctc
agcacctccatttctgtcttccgctccaaaccctcttctctctctctcaccctcatttcc
ctctccccgaaaaaccctaatcttcgcgccatgtcctctcgcccctccgccttcgacgct
cttatgtccggcgctcgcgccgccgcagccaagaaaaagccccaagcttcaccccccaag
aagcgaaaaaccctagaacctaaccctattgaaaacccccaattgctattgaaacccgaa
aatggcagtccaacccaagccccagaatccaaggaagtcaaagaagctctagaaagttct
agtaatggcggccaggtggttccccccgcgaaaaaagtgtgcgcggcggcaggtgctcag
gagcggacggcggaattgaagaaccgaatcgctctgttgaagaagaaagccggtgaattt
gacccgaaattgatggcgaattggggcgagggcgagagggttccgtttgcgtttgtttgt
ttggcttttgatttgattgcgaacgagacgggtcggattgtgatcacggatatagtgtgt
aacatgttgaggactgtaatgcacaccacgcctgaggatttggtgcccgtggtttatctg
gccgccaatcggattgctccggcgcatgagggattggagcttggaattggggatgcttcg
attatcaaggcacttgcagaggcttgtgggaggactgaagcacatgttaagaaacaatac
aaggaattgggagatttgggtcttgttgcaaaagcaagccgttcatctcaatctatgatg
cgcaagcctgattcgttaactgtcaccaaggttttcagtacatttcgtcaacttgctaag
gaatctgggaaggatagtcaggagaagaaaaagaaccatatcaaggcacttcttgttgct
gccactgattgtgaacctcaatatctgatccgtttgcttcagacaaagctgcgaattggg
ttggcagagcagactctcttagctgcattgggacaagctgcagtgcatactgaaaaacat
tcgacaccaccttctcatattcagagtcctatagatgaggctgcaaagattgttaagcaa
gtgtactctctacttcctgattacgataaaatcatccctgcccttttaagtggtggtgtg
tggaatcttccgaagacatgtagctttactttgggtgtcccagttggacctatgctagca
aagccaactaaaggtgtatctgagattgtacagaagtttcaggatacagaatacacctgt
gaatacaagtatgatggagaacgtgcccagatacattacatggaggatggttctgttgag
atatacagtcgaaatgctgaacgaaacactggaaagttccctgatgttgttgttgcagtg
tcgaggttaaagaagtcatctgtaacatcatttgttctggattgtgaattggttgcttat
gaccgtgtaaaacagaaaattcttcctttccaggtactcagcactagagctcgtaaaaat
gtggcaatgagtgatattaaggtcgatgtctgcatatttgcttttgacatgttgtatctt
aatggacaaccactaattcaagaacaactgaaagttcgtagagagagtctttatgactct
tttgtggaagaagctggattttttcagtttgccacagcaataacatcaaatgatattgaa
gaaatacaaaagtttcttgatgctgctgttgattcaagttctgagggtttaattatcaaa
acattgaacaaagatgctacttatgagccttcaaagcggtcacttaactggctgaaattg
aagaaagattacatggagagtattggggactcactagacttggtacctattgctgctttc
catggccgggggaaacgtacaggtgtctacggtgctttcctccttgcttgttatgatagc
aacaatgaagagtttcaaagcatttgtaaaataggcactggattctctgaagcaatgctt
gaagaacgttctgccagtctccgtactaaagtgatacccaaacctaagtcatactatcgt
tatgcagagacaatgaatcctgatgtatggtttgatgcctctgaggtttgggaagtgaaa
gctgcggacttgactattagccctgttcatcgtgccgcagttggcatagtagatcctaat
aagggtatttctcttcgatttccacgtcttgttcgtgttcgggaagataaacccccagag
caagcctcatcatctgcgcaggttgctgagatgtattctgcccaagctaacactcgttca
aacaatcaagatgacaacgaagatgattaa

DBGET integrated database retrieval system