KEGG   Propionibacterium acnes 266: PAZ_c16480Help
Entry
PAZ_c16480        CDS       T01971                                 

Gene name
nedA
Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
paw  Propionibacterium acnes 266
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAZ_c16480 (nedA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAZ_c16480 (nedA)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PAZ_c16480 (nedA)
Bacterial toxins [BR:paw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PAZ_c16480 (nedA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1664278..1665636)
Genome map
AA seq 452 aa AA seqDB search
MTLTTKLSALTTAGIMVVIGVPMVTQSAMASGRAPAPVAATTQPKLVTGDITSTDQSGTN
LFFGKKIVRNARGAIMKVDRTWPAAVPAPLPDVRADSSTRMLLGPVVDLAVNEHPEGVFY
RIPALATASNGDLLASYDLRPGSAGDAPNPNSIVQRRSRDNGRTWGPQTVIHAGTPGRRK
VGYSDPSYLVDPATGRILNFHVKSYDRGFATSEVGTDPDDRHVLHAEVSTSTDNGHTWTH
RDITREITSDPTTRTRFVASGQGIALLHGPHAGRLIAQMTVRNSVGQQAQSIYSDDHGIT
WHAGNPVGRMMDENKVVELSDGTLMLNSRDAARSGRRKVAYSQDGGLTWGPVKLVDDLID
PTNNAQIIRAYPNARAGSAKARILLFTNARNATERVNGTLSVSCDDGRTWVSTRPTCPGK
SDTPRQRCSPTGRWAFCGSATVFGTPPFRWGG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactctgaccacgaaactgagcgcgttgaccactgccggaatcatggtcgtcatcggg
gttcccatggtgacgcagtcggctatggcatcaggcagggctccggccccagttgcggcc
accacccagccgaaactcgtcacgggtgatatcaccagcaccgatcagtcgggcactaat
ctcttcttcggtaagaagatcgtccgcaacgccaggggagccattatgaaagtcgaccgg
acatggcccgcagcagtgccggcacctctgccggatgttcgtgctgattcgagcacacgg
atgctccttggccccgtcgtggatttggctgtcaatgagcatccggaaggcgttttttac
cgaatcccagcccttgcgaccgcttcgaacggcgatttgctggcttcctacgatctgcgt
ccggggagcgccggcgatgcgcctaaccccaattccatcgtgcagcgccgctctcgcgac
aatggtaggacgtggggtccgcaaaccgtcatccatgccgggaccccgggtcgcaggaag
gtgggatactccgatccttcctatctcgtcgatccagccacgggccgcatcctcaatttt
cacgtgaagtcctacgacagaggattcgccacatcggaggtgggcacggacccggatgat
cgtcatgttctgcacgccgaggtctctacctcgaccgacaatggacacacctggacccat
cgggacatcacgcgcgagatcacctcggatcccaccactcgaacacgattcgtggcatca
gggcagggcatagcgttgctccacggcccccacgctggacgtctcattgcccagatgacg
gtgcgcaacagcgtcggccaacaggcccagtcgatctattccgatgatcacggcatcacc
tggcatgctggcaacccggtgggccgaatgatggacgagaacaaggtggtggaactgtcc
gacggtaccctcatgctcaattccagggacgcagcccgttccggtcggcgcaaagtggcc
tattcccaagacggtggcttgacctgggggccggtgaagctggtcgatgacctcatcgac
cccaccaacaacgcccagatcattcgggcctaccccaatgcccgggccgggtcggcgaaa
gccaggatcctgttattcacgaatgcccgcaatgccacggaacgggtaaacggtactctc
tcggtctcctgcgatgacggacggacatgggtcagcaccagacctacatgcccggggaag
tcggatacaccacggcagcggtgcagtccgacggggcgttgggcgttctgtgggagcgcg
acggtattcggtactccaccattccgatggggtggttga

DBGET integrated database retrieval system