KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1667Help
Entry
PSEBR_a1667       CDS       T01472                                 

Definition
(GenBank) putative peptide synthase
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2021267..2034253
Genome map
AA seq 4328 aa AA seqDB search
MTDAFELPITLAHALQRRAALTPDRVALRFLADTPGQGVVLSYRDLDLRARTIAATLQAE
AALGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSILKDAEPRLL
LTSSDLREPLQAIESAPPVLCVDTLDPARAGQWRMPTLQDDDIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPVFSGVPCVLMSPAY
FLARPLRWLEAISEYGGTISGGPDFAYRLCSERVSDSALQRLDLSGWRVAYSGSEPIRLD
TLERFAEKFAPCGFTPDNFMASYGLAEATLFVAGTPRRHGIPSLRVDDAALTQNRAEPGQ
GSAVMSCGVSQPGHAVLIVEPATLQPLADNQVGEVWAAGPSIALGYWRNPEASAKTFVQH
DGRTWLRTGDLGFLRGGELFITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAF
AVNDGGEEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQQAPSVVVLLNPGALPKTS
SGKLQRSACRSRLADGSLDSYAQFPSAEAEVADESAPSSELQTLIGQIWREQLQVEQVQA
DDHFFLLGGNSIAATQVIARLRETLGLELNLRLLFEAPTLAAFAAAVANQQQDGGQPQGA
ISALSRDDALPQSLAQNRLWFTWQLDPTSHAYNIPGALHLRGELDEDALRASFQQLIERH
ESLRTRFLERDGVALQQVDPAGEFKLHVIDLGDLPADLREARARQVREDEAATPFDLEKG
PLLRVSLLRLDEDDHQLLVTLHHIIADGWSMNVLIEEFSRLYAAASQGQLAELAPLPLQY
ADYGSWQRQWLAQGEAEHQLRFWKQQLGAEPSALVLGTDHPRSAQRQRSAARHSLRLDKG
LCDTLRHVAQAHDATPFMLLLAAFQALLQRYTGQSDIRIGVPNANRPRLETQGLIGFFIN
TQVLRGQVDSRQPFAALLAQAREATLGAQVHQDLPFEQLLEAFPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLTLSFDYADELFEAATIERLA
AHYCNLLRAVCADPQQTIGDVPLLAADEHSQQQQWSAAPCAPASQWLPELLNEQARCTPQ
RTALRWDGGQLDYAELHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGVLAVIKAGG
AYVPLDADYPAERLAYMLHDSGVDLLLTQTELLERLPVCDGVSVIAMDALHLEQWPSNPP
GLHLHGDHLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYGLDATDVLMQKAPISFD
VSVWECFWPLITGSELVLAGPGEHRDPHRIAQLVQQFGVTTLHFVPPLLSLFVDEPLSAR
CSSLRRLFSGGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCTEADGERSPIG
RPLGNVLCRVLDSDLNPVPAGVPGELCIGGLGLARGYLGRPGLSAERFVADPLGPAGARL
YRTGDRARWNADGVIEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGIAQVAVLVRDTSTG
PQLIGYYTAPDVAQDQDALNIRLKAALAAELPDYMVPTQLLRLDAMPLGPSGKLDRRALP
EPQWQVREHVEPASALEQQIAGIWREVLGLARIGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRTLFEASELGAFAEQVRLIQASGQANRQPPIEKVDRSQPVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLDVGRFEAALQALILRHETLRTTFPSVDGVARQQVHGETGL
RMGWKDFSKLAADVREQRVQQLADSEAHQPFDLETGPLLRACLVKTAEHEHYFVLTLHHI
VTEGWAMDIFARELSALYEAFIDDRESPLEPLPVQYLDYSVWQRQWLESGERQRQLDYWT
AQLGREHPLLELPGDRPRPSVQSHRGELFRFDLSDDLAARVRAFNAQQGLTLFMTMTAAL
AVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLVNDA
RATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALLVDPARRLSELP
LLDTREQQQLLDSLGVEPGEHRLDQCLHELFDEQARMRPDAPALTFAGQTLTYAQLNSRA
NRLAWMLRERGVGPQVRVGLALERSLGMVIGLLAILKAGGAYVPLDPEYPLDRLSYMIED
SGVSLLLSDRAMFHALGALPEGVGCWCLEDDSAALAQYPDQPLPLINLPQHQAYLIYTSG
STGKPKGVVVSHGEIAMHCQAVIQRFGMRPDDCELHFYSINFDAATERLLVPLLSGAHVV
LRAQGQWDAEEICGLIRQHRINILGFTPSYGSQLAQWLATQGQTLPVRMCITGGEALTGE
HLQRIRAAFNPSLFFNAYGPTETVVMPLASLAPERLEEGAASVPIGSVIGARVAYILDAD
LALVPQGATGELYVGGAGLAQGYHQRPGMTAERFVADPFANEGGRLYRTGDLVRQRADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLEHDAVCEAVVLALDTPGGKQLAGYLVSDLASQ
DGEQQATLREALKNHLKAQLPDYMVPAHLILLASMPLTANGKLDRRALPLPDPELNRQHY
VAPSNALEQTLAAIWCDVLNVGQVGLNDNFFELGGDSILSIQVVSRARQQGIHFTPRDLF
QHQTVQTLAAVATRSQQVLAEQGLLQGESGLTPIQHWFFERQIPNQHHWNQALVLAPTTA
LEPQPLEQALRSVFQHHDALRLGFGETAGHWRAEHQPLSDAALLQHISVATAQDCEALFA
QTQSRFNLSTGPLLRAVLAQLPYGQQRLLIVIHHLVVDGVSWRVLMDDLQTVYRQLTTGQ
QVQLPAKTSPLRDWAARLQAYAGSESLREELEWWQVQLSGAQLQLPSANPEGGLQERHAE
TVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALTRVLCRWSGHASALVQLEGHGREALF
DDIDLTRTVGWFTSVYPVRLSPADEGFGASIKAIKEQLRAVPHKGLGHGVLRYMADAATR
QTMANLPRAAITFNYLGQLDQTLGQDALFQPLDAPLGAIHDPDAPLPNELSVDSQVSGGE
LVLRWTFSRERHDRQAIATLAEAYLDELQRLIEHCLTDEAGGLTPSDFPLAKMTQGQLDS
LPVPAGQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPQRFAQAWQAVIA
RHEALRASFCWNVGEDMLQIIHRPGRTPVDYLDWSEVPEDAQEAKLQALLKSERQAGFDL
LNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMDDFFEIYTALGENREPQLTVPP
RYRDYIGWLQHQSLAEARQWWQRNLKGFERTTPIPGDRPFLREHAGDSGGMIVGDCYTRL
DVEDGARLRELAQAHQLTVNTFAQAAWALVLRRVSGDRDVLFGVTVAGRPVELPQMQRTV
GLFINSIALRVQMPEDHQRCSVRQWLSDLLDSNMQLREYEYLPLVSIQEVSELPKGQPLF
DSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDE
STVQGLLGEFKRLLLALMAGLHGDMSELPLIGAEEQDFLIEGCNQSEHAYPLEQSYVELF
EARVAAHPQRPAVSCLDASYSYAELNARSNRLGHALIASGVGLDQPVALLAERDAELLGM
IVGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCTQACEAQAQALLDEFACSGRPKL
LVWEAVQASALSLENPGIYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLA
LSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLEHVQQQGISVLES
VPSLIQGMLAQERIGLDGLRWMLPTGEAMPPELAHQWLLRYPDIGLVNAYGPAECSDDVA
FFRVDLASTRGTYLPIGTPTDNNRLYLLDGALDLVPLGAVGELCVAGTGVGRGYVSDPLR
TAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIELGEIEARLHE
QPEVRDGAVGVQEGANGKHLVGYLVATDSALKSAERLERIKQRLRAELPEYMVPLHWLWL
ERLPLNVNGKLDRKALPTLEIGQLQSQDYQAPGNELEQTLADIWAQVLKVERVGVRDNFF
ELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVQELADYIDGLAASEITEEKVDRLND
LMAELEGM
NT seq 12987 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgttcgaactccccatcaccctggctcatgccctccagcgccgcgccgcg
ttgacgccggaccgggtggccctgcgcttcctcgccgacaccccagggcagggtgtggta
ttgagttatcgcgacctggacctgcgtgcccggaccatcgccgccaccttgcaggccgag
gccgcgctgggggatcgcgccgtgctgctgttccccagcggcccggattacgtcgcggcg
ttctttggctgcctctatgccggggtgattgccgtgccggcctatccgccggagtccgct
cgtcgccatcatcaagagcgcttgctgtcgatcctcaaagacgccgaaccgcgcctgctg
ctcaccagcagcgatctgcgcgagccgttgcaagccatcgaatcggcgccgccagtgttg
tgcgttgataccctcgacccggcccgcgccggacaatggcggatgccgacgctgcaggac
gatgacattgccttcctgcaatacacctccggctccaccgcgttgcccaagggcgtgcag
gtcagccacggcaacctggtcgctaacgaactgctgatccgtcatggcttcggcatcgac
ctgaaccccgatgacgtcatcgtcagctggctgccgctgtaccacgacatggggctgatt
ggcggcttgctgcagccggtgttcagcggcgtcccctgcgtattgatgtcgccggcctac
ttcctggcccggcccctgcgttggctcgaagcaatcagcgaatacggcggcactatcagc
ggtggcccggatttcgcctatcggctgtgcagcgaacgggtcagtgactcggccctgcag
cgtctcgacctgagcggctggcgcgtggcctattccggttccgagccgatccgtctcgac
acgctggagcggtttgccgagaagttcgccccgtgcggcttcacgccggacaatttcatg
gcctcctacggcctggcagaagcgaccctgttcgtcgccggtacgccacgccgccacggc
attccttcgctgcgggtggatgatgcggcactgacgcaaaaccgtgccgagccggggcag
ggcagtgcggtgatgagttgcggtgtcagccagcccgggcacgcggtgctgatcgtcgag
cccgccacgttgcagccgctggccgacaatcaggtcggtgaagtctgggctgctggcccg
agcatcgccctgggttactggcgcaaccctgaagccagcgccaagacctttgtccagcac
gacgggcggacctggctgcgtaccggtgacctgggtttcctgcgcggcggcgaactgttc
atcaccggccgcctgaaagacctgctgatcgtgcgcgggcataacctctatccccaggac
atcgagcaaaccatcgagcgcgaagtggaggtggtgcgcaagggccgcgtggccgcgttc
gcggtcaacgatggcggcgaggaaggcatcggtatcgctgcggaaatcagccgcagcgtg
cagaaaatcctcccgcccgaagccttgatcaaagccattcgccaggccgtggccgaggcc
tgccagcaagccccgagcgtggtggtgctgctcaatcccggcgcgttgcccaagacctcc
agcggcaagttgcagcgctcggcgtgccgcagtcgattggccgacggcagcttggacagt
tatgcacagttcccgtcagccgaggcagaagtcgctgacgaatctgcgccgtcatccgag
ctgcaaacgctcatcggccaaatctggcgcgagcaactgcaggtcgaacaggtccaggct
gacgatcatttcttcctgctgggcggtaattccatcgccgccacccaggtgatcgcacga
ctacgggaaaccctggggctggaactgaacctgcgcctgctgttcgaagcgccaaccctg
gccgcgttcgccgcagcggtggcgaaccagcaacaggacggcggccagcctcaaggcgcg
atcagcgcattgtcgcgcgacgatgcgttgccgcaatccctggcccagaaccgtttgtgg
tttacctggcagctcgatccgacgagccatgcctacaacattcctggcgccttgcacctg
cgcggcgagctggacgaagacgcgttgcgcgccagtttccagcaattgatcgagcgtcat
gagtccctgcgcacgcggttcctggagcgggatggcgtggccctgcaacaggtcgatccg
gccggtgaattcaagctgcatgtcatcgatctcggcgacctgcctgccgacttgcgcgaa
gcccgggcgcggcaggttcgagaagacgaagcggccacgccgttcgatctggagaagggg
ccgctgctgcgggtcagcctgttgcgtctcgacgaggatgaccatcagttgctggtgaca
ctgcaccacatcatcgccgacggctggtcgatgaatgtgttgattgaagaattctcccgc
ttgtacgccgccgcctcccaaggtcagctcgccgagctggcgccgttgcccttgcaatac
gccgactacggcagttggcagcgccagtggctcgcccaaggcgaggccgagcaccaactg
cgcttctggaagcagcaactgggcgcggaaccttcggccctggtgctgggcacggatcat
ccacgcagcgctcaacgccagcgcagtgccgcgcggcatagcctgcgcctggacaagggc
ctctgcgataccttgcgccacgtggcccaggcacacgacgcaacgccgttcatgctgttg
ctggcagccttccaggcgctgttgcagcgttacaccggccaatccgatatccgcatcggc
gtgcccaacgccaaccgtccgcgcctggaaacccaggggctgatcggcttcttcatcaac
acccaggtgctgcgcgggcaggtcgattcacgtcagccattcgctgcgctgctggcccag
gcccgggaagccacactcggtgcccaggtccaccaggacctgccgttcgaacaactgctc
gaagcgtttcccgaggcgcgtgaacaaggcctgttccaggtgatgttcaaccaccagcag
cgtgacttgagtgccttgcggcgcctgccggggttgctggccgaggagttgccgtggcac
agccgcgaagccaagttcgacctgcaactgcacagcgaagaagatcgcaacggccgcttg
acgctgtcgttcgactacgccgacgaactgttcgaggcggcgaccatcgagcggctggcg
gcgcattactgcaacctgttgcgggcggtctgcgccgatccgcaacaaaccatcggcgat
gtgccgttattggccgccgatgaacacagccaacagcagcaatggagcgcggccccgtgc
gcgccggccagccaatggctgccggagctgttgaacgaacaggcccggtgcacgccgcaa
cgcactgcgttgcgctgggacggtggtcaactcgattatgccgagctgcacacccaggcc
aatcgcctggcccattacctgcgggacaagggcgttggcccggacgtgtgcgtggcgatt
gccgccgagcgctcgccgcagctgctcatcggtgtgctggccgtcatcaaggccggcggt
gcctatgtgccgctggatgcggactacccggccgaacgcctggcctacatgctccacgac
agtggcgtcgacttgctgctgacccaaaccgagctgctcgaacgtttgccggtgtgcgac
ggcgtcagtgtcatcgccatggacgccctgcatctggagcaatggccaagcaatccgccg
ggcctgcacctgcacggcgaccatctggcctacgtgatctacacctccggctccaccggc
cagcccaaaggcgtcggcaatacccacgcggccctggccgagcgcctgcaatggatgcaa
gcgacctacgggctggatgccaccgatgtgctgatgcaaaaagcgccgatcagtttcgac
gtgtcggtctgggaatgcttctggcctctgatcaccggcagcgaattggtactggccggc
cccggcgaacaccgtgacccgcaccgcatcgcccagttggtgcagcagtttggcgtcacc
acgctgcacttcgtgccgccgttgctcagcctgtttgtcgatgagccgttgagcgcccgc
tgcagcagcctgcgtcggctgttctccggtggcgaagccttgcccgccgaactgcgcaac
cgggtgttggcgcaactgccggcggtgcaattgcacaaccgctacggcccgaccgaaacc
gcgatcaacgtcacccattggcattgcaccgaggccgatggcgagcgctcgccgatcggc
cggcccctgggcaacgtcctgtgccgggtactcgacagcgacctcaatcccgtgccggcc
ggcgtgcccggcgagctgtgcatcggcggcctgggcctggcccggggttacctcggtcgt
ccgggcctgagcgccgagcgttttgtcgctgaccctctggggccggccggtgcgcggttg
taccgtaccggcgaccgcgcgcgttggaacgccgacggcgtgatcgagtacctcggccgc
ctcgaccagcaggtcaagctgcgcggttttcgggtcgagccgcaggaaatcgaagcgcgc
ctgctggcccaggacggcatcgcccaagtggcagtgctggtgcgcgacacctcgaccggc
ccgcagttgatcggctattacaccgccccggatgtcgcccaggaccaggacgcgttgaac
attcgactcaaagccgccctggccgccgaactgccggactacatggtgcccacccaactg
ctgcgcctggacgccatgcccctgggcccgagcggcaagctcgaccgccgcgccttgccc
gagccgcaatggcaggtgcgcgagcacgtcgagccggccagcgccctcgagcagcaaatc
gccggcatctggcgcgaggtactgggccttgcgcgcatcggcctgcgggacgatttcttt
gccctcggcggtcattcgctgctggcgacccagatcatttcccgcacccgccaggcctgc
gacgtcgaactgccgctgcgcactctgttcgaggccagcgagctgggcgccttcgccgaa
caggtgcgcttgatccaggccagcggccaggccaaccgtcagccaccgatcgagaaagtc
gaccgtagccaaccggtgccgctgtcctattcccagcagcgcatgtggttcctctggcag
atggagccggacagcccggcctacaacgtcggtggcatggcgcggttgcgcggggtgctg
gatgtcgggcgtttcgaggcggccttgcaggcgttgatcctgcgccacgaaaccctgcgc
accacgttcccgagcgtcgacggcgtggctcgccagcaagtgcacggtgagacgggcttg
cgcatgggttggaaggatttctcgaagctggctgctgacgtccgcgaacagcgggtgcag
caactggccgacagcgaggcccaccagccctttgacctggaaaccgggccgctgctgcgg
gcctgcctggtcaagaccgccgagcatgagcattactttgtcctgacgttgcaccacatc
gtcaccgaaggctgggcgatggacatcttcgcccgtgaactgagcgcgctgtacgaagcc
tttatcgacgatcgcgaatcgcccctggaacccttgccggtgcagtacctggactacagc
gtctggcagcgtcagtggctggagtccggcgagcgtcagcgacaactcgactattggacc
gcgcaactgggccgcgaacatccgctgctggaactgcccggcgaccgcccgcgtccatcg
gtacaaagtcatcgcggtgaattgttccgtttcgacctcagtgatgatttggcggcgcgg
gtccgtgccttcaacgcgcaacagggcctgaccctgttcatgaccatgaccgccgccctg
gccgtgctgctctatcgctacagtggccagaccgacctgcgcatcggcgcgccggtggcg
aaccgcatccgcccggaaagcgaagggctgattggggcgttcctcaacacccaggtcctg
cgctgccaactcgacgggcagatgtcggtgggcgaactgttcgagcaggtgcgccacacc
gtgattgaaggccagtcccatcaggatttgcctttcgatcacctggtagaagccctgcag
ccgccgcgcagtgcggcctacaacccgctgttccaggtgatgtgcaacgtgcagcgctgg
gagttccagcagagccgcacgctggccggcatgactgttgaatacctggtcaacgacgcc
cgggccaccaagttcgacctcaacctggaagtcaccgacctggatcagcgcctgggttgc
tgcctgacctacagcaccgacctgttcgacgaaccgcgcatcgcgcgcatggctgggcac
tggcgcaatctgctggaagcgttgctggtcgatccggcccgacgcctgagcgaactgccg
ttgctggacacccgcgagcagcaacagctgctcgacagcctgggcgtcgagcccggtgag
catcgcctggaccaatgcctccacgaactgttcgacgaacaggcgcggatgcgtcccgat
gcgccggccctgactttcgccgggcagaccctgacgtatgcgcaactgaacagccgcgcc
aatcgcctggcctggatgctgcgtgagcgaggcgtcgggccgcaggtgcgggtcggcctg
gccctggagcgttcgctgggaatggtcatcggcctgctggcgatcctcaaggctggcggt
gcctacgtacccctggacccggaatacccgctggaccgcttgagctacatgatcgaggac
agcggcgtcagcctgctgctcagtgacagggcgatgttccacgccctcggtgcattgccc
gagggcgtgggctgctggtgcctggaagatgattcggccgccctggcccaatacccggat
cagccgctgccgctgatcaacctgccgcaacaccaggcgtacctgatctacacctccggc
tccaccggcaagcccaagggtgtggtggtgtcccacggtgaaatcgccatgcattgccag
gcagtgatccagcgtttcggcatgcgcccggacgattgcgagctgcatttctattccatc
aacttcgacgccgccaccgaacgcctgctggtgccattgctcagcggcgcccacgtggtg
ctgcgggcccagggccaatgggacgccgaggaaatctgcgggctgattcgccagcatcgc
atcaacattcttggcttcacccccagctacggcagccagttggcccagtggttggcgacc
cagggccagaccttgccggtgcgcatgtgcatcaccggcggcgaagccctgaccggcgaa
cacttgcaacgcattcgcgcggcgttcaacccgagcctgttcttcaacgcctatggcccg
accgaaaccgtggtcatgccattggcgagcctggctccggagcgactggaagagggcgcg
gccagtgtgccgattggcagcgtgattggcgcccgcgtggcgtacatcctcgacgccgac
ctggcgttggtgccgcaaggcgccacgggagagttgtatgtgggcggcgccggtctggcc
cagggttatcaccagcgtccggggatgaccgccgagcgtttcgtcgccgacccgttcgcc
aacgagggcggacgcctgtatcgcaccggcgacctggtgcgccagcgtgccgacggtctg
gtggaatacctgggacggatcgaccatcaggtgaaaatccgcggcttccgcatcgaactg
ggggaaatcgaaacccgcctgctggaacatgacgcggtgtgcgaggccgtggtactggcc
ctcgacacgcccggcggcaagcaactggccggctacttggtgagcgacctcgccagccag
gacggcgagcaacaagcgaccctgcgcgaagccttgaaaaaccacctcaaggcccagctg
ccggactacatggtgcccgcgcacctgatcctgctggcgagcatgccgctgaccgccaac
ggcaagctcgaccgccgtgccttgccgttgcccgatcccgaactcaatcgccaacactac
gtggcgccaagcaacgccctggagcagaccctggcggcgatctggtgcgacgtgctgaac
gtcgggcaagtgggtcttaacgataacttcttcgagctgggcggtgattcgatcctgtcc
atccaggtggtcagccgcgcccggcagcagggcattcacttcacgccccgggacctgttc
cagcaccagaccgtgcagaccttggccgcggttgccacgcgcagccagcaggtgcttgcc
gagcagggcctgttgcagggggagtccgggttgacgccaatccagcactggttcttcgag
cgccagatccccaaccagcaccactggaaccaggcgctggtgctggcgccgaccacggcc
ctggaaccgcaacctctggaacaggcgctgcgcagcgtcttccagcaccacgatgccttg
cgcctgggcttcggcgaaaccgccgggcactggcgtgccgagcaccagccgttgtctgac
gcggcgttgttgcagcacatatccgtggccaccgcgcaggattgcgaagcgttgtttgcc
cagacgcagagccgtttcaatctatcaaccgggccattgctgcgcgcagtactggcgcag
ttaccctacggccagcaacgtttgctgatcgtcatccatcacctggtggtcgacggcgtg
tcgtggcgggtgctgatggacgatttgcaaaccgtctaccgccagctcaccaccgggcag
caggtgcagttgccggccaagaccagcccattgcgcgactgggccgcgcgcttgcaggct
tacgccggcagcgaatccctgcgcgaagaactggagtggtggcaagtgcagttgagtggc
gcgcagctgcagttgcccagcgcgaatcccgagggcgggctgcaggaacgtcatgctgaa
accgtcagcgtgcgcctggacgccgagcgcacccggcaactgttgcaacaggcgccgagc
gcctaccgcacccaggtcaacgacctgctgcttaccgcgctgacccgggtgctgtgccgt
tggagcgggcatgcctcggccttggtccagctcgaaggccacggccgcgaagcgctgttc
gacgacatcgacctgacccgcaccgtcggctggttcaccagcgtctatcccgtgcgcctg
agcccggcggacgaaggcttcggtgcctcgatcaaggccatcaaggaacaattgcgtgcg
gtgccccacaagggcctaggccatggcgtattgcgctacatggccgacgcggcgactcgc
cagacgatggccaacctgccgcgcgcggcgatcaccttcaactacctgggccagctcgac
cagaccctgggtcaggatgcgctgttccagccgctggatgcgccgctgggcgcgatccac
gatcccgatgcgccgctgcccaatgagctgagcgtcgacagccaggtcagcggtggcgag
ttggtgctgcgctggacgttcagccgcgaacggcatgatcgtcaggctatcgccaccctg
gccgaggcctacctcgatgagttgcaacgcctgatcgagcactgcctgacggacgaggcg
ggcggcctgacgccatcggacttccccctggcgaagatgacccagggccaactcgacagc
ctgccggtaccggccgggcagatcgaagacgtctacccgctgacaccgatgcaggaaggc
atgctgttgcacaccttgctggaaccgggcacaggcctgtactacatgcaggatcgctat
cgcatcaacagcgaactggacccgcagcgttttgcccaggcctggcaagcggtcatcgcc
cggcatgaagccttgcgggcgtcgttctgctggaacgtcggcgaagacatgctgcaaatc
atccacaggccgggccgcacaccggtggactatctcgactggtccgaggtgcccgaagac
gcccaggaagccaagctccaggcgctgctcaagagcgagcgccaagccggtttcgatctg
ttgaaccaggcgccgtttcatctgcgactgattcgggtcggcgcggcacgctactggttc
atgatgagtaaccaccacatcctcatcgatgcgtggtgccgttcgctgctgatggacgac
ttcttcgagatctacaccgccctgggtgaaaaccgcgaaccgcagttgaccgtgccaccg
cgctatcgcgactacatcggctggttgcagcaccagagcctggccgaggcccggcagtgg
tggcagcgcaacctgaaaggcttcgagcgaaccaccccgatccctggcgaccggccgttt
ctgcgcgagcacgccggtgacagcggcggcatgatcgtcggcgactgctacacccgtctc
gatgtcgaggatggcgcacggctacgggaactggcccaggcccatcaactgacggtcaac
acgttcgcccaggcggcgtgggccctggtgctgcggcgggtcagcggcgaccgcgacgtg
ctgttcggcgtcactgtggccgggcgtccggtggagctgccgcagatgcaacgcaccgtg
gggctgttcatcaacagcatcgccttgcgcgtgcagatgcctgaagaccatcagcgctgc
agcgtgcgccagtggctcagcgatttgctggacagcaacatgcaactgcgcgagtacgaa
tacctgccgctggtgagcatccaggaggtcagcgaattgcccaagggccagccgctgttc
gacagtttgttcgtgttcgagaatgccccggtggaggtctcggtgctggaccgcgcccaa
agtctcaatgccacttcggactcgggccggacccacaccaatttcccgctgacggcggtc
tgctacccgggagatgacctggggctgcacctttcatacgaccagcgctacttcgatgaa
agcaccgtccaggggctgctgggcgagttcaagcggttgctgctggcattgatggcgggc
ttgcacggcgacatgagcgagctgccgctgatcggtgccgaagaacaggacttcctcatc
gagggctgcaaccagagcgagcatgcctatccgctggagcagagttacgtcgagctgttc
gaggcccgagtcgcggcccatccgcagcgccctgcggtcagttgcctggacgcgagctac
agctacgccgagctgaatgcgcgcagcaaccgcctcggtcatgccctgatcgcgtccggt
gtcggcctggatcagcccgtggcgctgctggccgaacgggatgccgagctgctgggcatg
atcgtcggcagcttcaaggccggtgccggctacctgccgctggacccgggcctgccgagc
cagcgcctgagccgcatcatcgaattgagtcgcacgccgttgttggtttgcacccaggcc
tgcgaggcccaggcgcaggctttgctggacgagttcgcctgttccgggcggccgaagttg
ctggtgtgggaagccgtccaggccagcgctctttcgctggaaaacccagggatctacagc
gggccggataacctggcctacgtgatctacacctccggttccaccggcctgcccaaaggc
gtgatggtggaacagcggggcatgctcaacaaccaactgagcaaggtgccgtacctggcg
ctgagcgaggcggatgtgatcgcccagacggcgtcccagagcttcgatatttcggtctgg
cagttcctggccgcgccgttgttcggtgcccgggtcgacatcgtgcccaacgccattgcc
cacgacccgcaagggttgctggagcatgtacagcagcagggcattagcgtgctggaaagc
gtgccgtcgttgatccagggcatgctcgcccaggaacgcatcggtctggacggcttgcgc
tggatgctgcccaccggcgaagcgatgccgccggaactggcccaccagtggttgttgcgt
tacccggacattggtctggtcaatgcctacggcccggcggaatgctccgacgacgtggcg
ttcttccgggtcgacctggcctcgacccgtggtacgtatctgccgattggcacgcccacc
gacaacaatcgtctgtacctgctcgacggtgcgctggacctggtgccgctgggtgcggtg
ggggagttgtgcgtggcgggcaccggggtcgggcgtggttatgtaagcgatccgttgcgc
accgccccggtctttgtgccgaacccgttcggcgcgccgggggagcggctgtaccgcacc
ggcgacctggcacggcggcgcagcgatggggtgttggagtatgtcggacgcatcgaccat
caggtaaagatccgcggctaccgcatcgaactgggggaaatcgaagcacgcttgcatgaa
cagccggaagtgcgcgatggggcggtgggtgtgcaggagggcgccaatggcaagcatctg
gtgggctacctcgtggccaccgactcggcgctcaaatccgccgaacgactggagcgcatc
aagcagcgcctgcgggccgaactgccggaatacatggtgccgctgcactggctgtggctc
gagcgcctgcccctcaacgtcaacggcaaacttgatcgcaaggccttgccgaccctggag
atcggtcagttgcaaagccaggactaccaagcccccggcaatgaactggaacagaccctg
gcagacatctgggcccaggtgctgaaagtcgagcgggtgggggtgcgggacaacttcttc
gaactgggcgggcattccctgctggcgacgcagatcgcctcacgggtgcaaaaggccctg
caacgcaacgtaccgctgcgggcgatgttcgaatgcagcacggtgcaggaactggccgac
tacatcgatgggctggcggccagcgaaatcactgaggagaaggtggatcggttgaatgat
ttgatggcggagttggaaggaatgtag

DBGET integrated database retrieval system