KEGG   Pogonomyrmex barbatus (red harvester ant): 105424214Help
Entry
105424214         CDS       T04903                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00480  Glutathione metabolism
pbar00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pbar00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    105424214
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105424214
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105424214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Glutaredoxin GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-GeneID: 105424214
NCBI-ProteinID: XP_011632642
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MSTKHLSTDSALPPLVPDKIRLYSMRFCPYAQRIHLILDAKQIPYDVVYVNLTNKPNWLI
EKSPLNKVPCIELEEGKTLYESLIIAEYLDEAYPENKLFPSNPLAKAQDKLLIDRFHAVI
SSMYKALYLEAELAQDMFNDVLNDLQFFNRELVERKTPFFGGKEPGMVDYMIWPWYERAD
VLKLIKGEQFTIQKNSVLQLIEWIDAMKDNPVVKKSFLKTEIHAKYVRSRLAGTPQYDFI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaaacatctaagtaccgattcggcactgccgcctctcgtgcccgacaaaata
cgtctatacagtatgcgcttttgtccatatgcgcaaaggatacacctgatattggatgcc
aaacaaattccgtacgacgtagtatatgtaaatttaacaaacaaaccaaattggttgata
gaaaagagtcctcttaataaagttccttgtatcgaactggaagaaggaaaaacattatat
gaaagcctaattattgctgaatatttagatgaagcttatcctgaaaataagttatttcct
agtaatccgttggcaaaagctcaggataagttattgattgatagatttcatgcggtaata
tcatctatgtacaaggcactttatctagaagcggaattagcgcaagatatgttcaatgac
gtattaaatgatttacaattttttaatcgggaattggtagagaggaaaactcctttcttt
ggaggcaaagaacccggtatggtagattatatgatatggccgtggtacgaaagagcagat
gtactaaaattaataaaaggggagcaatttaccatacaaaaaaattctgtcctgcaattg
attgaatggatagatgccatgaaagacaatcctgtagtgaagaaaagttttctaaaaact
gaaatacatgccaaatatgtacgcagtcgtttagctgggacacctcagtatgatttcata
tga

DBGET integrated database retrieval system