KEGG   Pogonomyrmex barbatus (red harvester ant): 105425854Help
Entry
105425854         CDS       T04903                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2 isoform X1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbar00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105425854
Enzymes [BR:pbar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105425854
Chromosome [BR:pbar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105425854
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105425854
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MFGIADTADCGSSGESADIPGSITKTPAISQKRHLSPPGGFDAPSCAKMPKLLNKKGCND
MSHRLDSKKMLSSSSSSSSLSILSSSSSSSSSSSSSTTTRCLRARKTFTQQMLQAFENTS
LTYSGNASIRDRGSDGRRSDYEESSSDGRLSAREDIMTQHFGFELKEARVLLYDIMHSEK
YRELTIMSDKPSSASDKKSKLWEVEKILQKRRQNGESFYLIKWKDWDTEYNTWEPVRNLV
NCKDLLDEFENERQKLIDQFKAAANFYPDARDIEHFLDQLRRSKSVSIDDAVSNAAAALF
EDTMYIEIRRFLKNSSHGTKLEAKIKRQIMRTLLIELRYDQLESLQDWQNEMNSITKGKP
TIQVENLVDLESAPQDFYYIDSYLPGAGIIIPDDPPIGCECVGDCESGNRSSCCFGQNGA
TSLPYTSARRIRVPLGTPIYECNKRCACPSTCPNRVVQQGSGTQLCIFRTDNGRGWGVRT
RRAIKKGTFVTQYVGEVISNEEADKRGRQYNVTGRTYLFDLDYNETDGQCPYTVDAAMYG
NISHFINHSCEPNLAVYAIWINCLDPNLPNLALFAIKDIRQNEELTFDYMCQTPRDNLKR
QQLLDNEPKNENAVSKNRILCKCGASTCRRYLF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcattgcagacacggcggattgcggtagcagcggtgaatcggcagatatacct
ggcagcataactaaaacgccagctattagtcaaaaacgacacctctcccctcctggaggt
tttgacgcaccatcgtgcgctaagatgcctaaacttctcaacaaaaagggttgtaacgac
atgtctcatcgattggacagcaaaaagatgctctcttcctcctcttcctcttcctcactg
tcgatattgtcatcatcatcgtcatcatcatcatcatcatcatcgtcaacaacaacgagg
tgcttgcgagcgcgcaaaacattcacgcagcagatgctccaagcgttcgagaacacttct
ctcacgtacagcgggaatgcaagcataagggatcgaggtagtgatggtcggcgatctgac
tatgaggaatcgtcgtcggacggtagattgtctgcgcgagaggacatcatgactcagcac
tttggtttcgaactaaaggaagcacgggtgttgttgtatgatatcatgcatagcgagaaa
tatcgtgagttaacgataatgtccgataaaccctcttcggcttccgataagaagtcgaag
ctttgggaagtagaaaagattctgcagaagcgcaggcagaatggcgaatcattttatttg
atcaagtggaaggactgggacaccgagtacaacacgtgggaaccggtgcgtaatctcgtc
aactgcaaagatttgctagacgagtttgagaacgaacggcaaaaattaatcgatcaattc
aaggcagcggcgaatttctacccggacgcgcgcgacatcgagcattttctggatcaactg
cggcgtagtaaaagcgtgtcgattgatgacgccgtgtccaatgccgccgccgccctcttc
gaggatactatgtacatagagattcgacgtttcctaaagaattcgtcgcacggtaccaaa
ctcgaggcgaagatcaagcggcaaataatgcgcacgctgctaattgagctgcgttatgat
caactcgagtcgctgcaggactggcagaacgagatgaatagtattacaaagggcaagccg
acgatccaagtggagaacctggtggatctcgagagcgcgccgcaggacttttactatatc
gacagttatttgccgggcgcgggtattataataccagacgatccgccgatcggttgcgag
tgcgtcggcgactgtgaatctggcaatagatctagctgctgtttcgggcaaaacggtgct
acatcgttgccgtacacgtcggcgcgtcggatacgcgtgccactgggtacgcccatctac
gagtgtaacaaacgttgcgcctgtccgtcgacctgcccgaatcgagttgtacagcaaggc
agcggtactcaactgtgcatattccgcacggacaatggacgcggttggggtgtgcgcacc
cgacgcgcgattaagaagggcaccttcgtcacccagtacgtgggcgaggtaattagtaac
gaagaggcggataagcgcggcagacagtacaatgtgaccggtcgtacgtatctctttgac
ctcgactataacgagactgatggccaatgtccgtacaccgtggacgccgctatgtacggc
aatatttcgcactttatcaatcattcatgcgaacctaatctcgcggtttacgcgatttgg
atcaactgcctagacccgaacctgccgaatctcgcgttgtttgctattaaagacatccga
cagaacgaagaactcactttcgattatatgtgtcaaacgccgcgggacaacttgaagaga
cagcagctactggacaatgaaccgaagaacgaaaatgcagtctcaaaaaacaggatactt
tgcaagtgtggtgcttcaacgtgtcggcggtatctgttttaa

DBGET integrated database retrieval system