KEGG   Pogonomyrmex barbatus (red harvester ant): 105426716Help
Entry
105426716         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neuroendocrine convertase 2-like
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     105426716
Peptidases [BR:pbar01002]
 Serine Peptidases
  Family S8: subtilisin family
   105426716
Chaperones and folding catalysts [BR:pbar03110]
 Intramolecular chaperones
  Subtilisin family
   105426716
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MLLLAVIGLLVLAGTTTAEVFTNTFLVRMRQPAERHEADNVALRNGFVNLGPVLGSQTEY
HFVHRALPHVRSKRSVPHTRRLKVDPMVAMAIQQAGFKRVKRGYKPLSVDNLVPLYEIKN
PTNPASKDPTDPFFKYQWYLKNVGQNGGKPKLDLNVEAAWAQGVTGKNVTTAIMDDGVDY
MHPDLKYNYNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVAAARDNGVCGVGVAYD
SKIAGIRMLDQPYMTDLIEANSMGHEPDLIDIYSASWGPTDDGKTVDGPRNATMRAIVRG
VNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLA
STFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLT
VLTSKRNSLFDAKDRFHWTMNGVGLEFNHLFGYGVLDAGAMVALAKKWKTVPPRYHCEAG
TMLDTQKVTSDRSILVKIKTDACAGTEYAVNYLEHVQAVISVNATRRGDLELFLTSPMGT
RSMILSRRVNDDDHRDGFTKWPFMTTHTWGEYPQGTWLLEVSFNSQTPQHGWLKEWTLML
HGTREPPYTGLSTADPHSKLAIVKKAHEERFSAI
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgctactactcgcggtgatcgggctcctcgtcctcgccggcacgacgaccgccgaggtc
tttaccaacacgttcctggtgaggatgcggcagcctgcggagaggcacgaagccgataac
gtcgcgctgaggaacggcttcgtcaatctcgggccggtattgggcagtcagacggagtat
catttcgtacatagagctttaccgcatgtacgaagcaaacgatctgtgccgcacacgcga
agattaaaggtcgaccctatggtggccatggctatacaacaggctggcttcaagagagtg
aaaaggggttacaagcccctaagcgtggacaacctcgtgccgctgtacgaaattaagaat
cccacgaatccggcgagcaaggatccgacagatccctttttcaagtaccaatggtatctg
aagaatgtcgggcagaacggcggcaaaccgaagctggatctaaacgtcgaggccgcctgg
gctcagggtgtcacggggaaaaacgtgacgacggccatcatggacgacggtgtcgattac
atgcatccggatcttaaatataattacaacgcgaaagcttcttacgacttcagcagtaac
gacccttatccgtacccgaggtacaccgacgactggtttaacagccacggcacgaggtgc
gccggggaggtcgcggccgcgcgcgacaacggggtgtgcggcgtcggggtggcgtacgac
tcgaagatcgccggtatccggatgctggaccaaccctacatgaccgatctgatcgaggcg
aacagcatgggccacgagcccgatctcatagatatttatagcgcctcctggggacccacg
gacgacgggaaaacggtggacggaccgcgcaacgctaccatgagggccatcgttcgtggc
gttaatgagggcagaaacggattgggcaatatctacgtttgggcctccggggacggcgga
gaggaggacgattgtaattgtgacgggtatgccgcaagtatgtggaccatcagcatcaac
agtgccatcaacgacggtcagaacgcgcattacgacgagagctgctccagcaccctggct
tccacctttagcaacggcgccaaagatcccaacacgggggtggctaccacagatctgtat
ggaaaatgcacgacgactcacagcgggacttccgccgcagcgccggaagccgcgggagta
ttcgcgcttgctctcgaagctaatccgcaactgacctggagagatattcagcatttgacc
gtcctaacttcgaaaagaaattctctgttcgacgcgaaggatagatttcattggaccatg
aacggcgtcggactcgaatttaatcatcttttcggatacggcgtcctggatgcgggcgct
atggtagccctggctaaaaaatggaaaacggtacctccgagataccattgcgaggccggc
accatgctcgacactcagaaagtcacgagcgatcgatccatcctcgtgaagattaaaact
gacgcgtgcgccggcacggaatacgccgtcaattatttggagcacgtgcaagccgtcatc
tccgtaaatgcaactcggcgcggtgatctcgagctgttcctcacgtctccgatgggcacc
agatctatgatcttgagtcgccgagtgaacgacgatgatcacagggatggattcacgaag
tggccgttcatgacaacgcacacgtggggagagtaccctcaaggaacttggttattggag
gtaagcttcaactctcagacgcctcaacacggatggctaaaagaatggacgctgatgctc
cacggcactagggaaccaccatacacgggattatcgacggcggatcctcactccaaacta
gcgattgtcaagaaggcccacgaggagcgtttcagcgcgatctaa

DBGET integrated database retrieval system