KEGG   Pogonomyrmex barbatus (red harvester ant): 105426973Help
Entry
105426973         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glycerol-3-phosphate dehydrogenase, mitochondrial-like
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pbar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    105426973
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105426973
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 752 aa AA seqDB search
MMASLRLFIAGASAVGAGTLTSYFLLSDTVYADKGKPRPPRRTLPTREDQVKTLKSQDYD
VLIIGGGATGAGCALDACTRGLKTALVEADDFASGTSSRSTKLIHGGVRYLQKAIMQLDV
EQYRMVKEALHERASMLESAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTVKS
SYYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAIALTASRHGATVVNHVKVVN
LLKGLDRDGKRVLIGAHLKDELTGEEWDVKAKAIINATGPFTDHIRKMDDQNVQSICSPS
SGVHIVLPGYYXXXXXXXXDPATSDGRVIFFLPWTKATIAGTTDLPCEVTHNPRPTEDEI
MFILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLITI
AGGKWTTYRAMAQETIDAAIKACDLQPERPCQTDGFLLEGAQGWSPTMYIRLVQDFGLEC
EVAQHLSKSYGDRAFAVAKMASLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDM
IARRLRLAFLNVQAAQEALPVIIDIMAEELHWSAEEKKKQYREASEFLAQEMGQMVNRAS
RDKIPINLTKEEIQLYIKRFGIIDKDKKGYVSINDIRRGLKVLDIKMNQDEMHSLLNEID
LTYNGQMELQDYLQLFGDKEVPGEELHEILREIDTNMNGQVELDEYLQMMSAIKSGHVAY
SRFARMAEMEEAQHEKEMLKKQISVERSGGGL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatcacttagattgtttatagctggagcaagtgctgtgggtgccggtactctt
acttcatacttccttttgtcagatacggtatatgctgataaagggaaaccaagaccacct
cgaaggactttgccgacacgagaggatcaagtaaagactttaaaatcacaagactatgat
gtgctgataatcggaggtggtgcaacaggtgcaggatgtgctctggacgcttgcacacga
ggtctgaaaaccgcattggtcgaagctgacgattttgcatctggcacctcatctcgaagc
acaaaattaattcatggtggtgtacgatacctacaaaaagcgattatgcaattggacgtc
gaacaatacagaatggtgaaagaggcgcttcacgaacgcgcatcgatgttggaaagcgca
ccgcatctggcgcatccattgcccattatgctgccagtttatacatggtggcagattcct
tattactggtttggaattaagatgtatgatttagtagcaggtagcaaaacagtcaaatct
tcgtattatttgagtaaatcaaacgctctggaactttttccaatgttgaaaggtgataaa
ctgacaggagctattgtctattacgatggtcagcaagatgatgctagaatgaatttggca
atcgctctaacagcttcgagacatggggcgacagttgtaaatcatgttaaagtagtcaat
ttattgaaaggtctcgatagagatggcaagcgagttcttataggagctcatcttaaagat
gaacttacgggggaggaatgggatgtaaaggctaaggcaataatcaacgcgactggcccc
ttcacagatcacatcagaaagatggacgatcaaaacgtccaatcaatctgctctccatct
tctggcgttcatatagtattgccaggatattacnnnnnnnnnnnnnnnnnnnnnnnngat
ccagcaacgagtgatggccgagtaattttctttttaccatggacaaaagcaacaatcgca
ggaacgaccgatttgccttgtgaggtaactcataatcctcggcccacggaagacgagatt
atgttcatcttgcaagaagtgaaaaactacctgaatccagatgtcgaggtgcgccgtgga
gacgttctttccgcctggagcggtatcaggccgctcgtttcggatccgaataaaccgaac
acgcagtcgctcgccagaaatcacattgtacacgttagtcctacgaatctcatcacaata
gcaggtggcaaatggacaacttatcgagcgatggctcaggaaaccattgacgcagctata
aaagcttgtgacttacaaccagaaagaccttgccagaccgacggctttcttctagaaggt
gctcagggctggagcccgacaatgtacattagattggtgcaggatttcggattagaatgc
gaagttgcacaacatttatccaagagctatggagatcgtgcatttgccgtagctaaaatg
gcttctcttacaggaaaacgatggccgattattggaaaaaaaattcatccggaatttccg
tacattgacgctgaaatacgttatggtgtgcgagaatacgctagaactgcgatcgatatg
atcgcgcgacgattgcgactcgctttccttaatgttcaggcggctcaagaagcattacca
gtcattatagatatcatggccgaggaattgcattggtcggcggaggagaaaaaaaagcaa
tatcgagaagccagtgagtttcttgctcaagagatgggtcagatggtgaaccgtgcttcc
cgtgacaaaattcctatcaatctcactaaagaagaaattcaactctacattaaacgcttc
ggtattatagacaaggacaagaagggatacgtgtctatcaatgacattaggcgaggatta
aaggtattagatataaaaatgaaccaggacgagatgcacagtttattgaatgaaattgat
ctcacttacaatggccaaatggaattacaagactatttacagctctttggagataaagaa
gtaccgggtgaagaacttcatgaaattctacgcgaaatcgacaccaatatgaacggtcaa
gttgaattggatgaatatcttcagatgatgtcagctataaaatctggtcatgtggcatat
tcacgtttcgcgcggatggctgaaatggaggaagcgcagcacgaaaaggaaatgcttaaa
aaacaaataagcgtcgagagatcaggtggaggactgtaa

DBGET integrated database retrieval system