KEGG   Pogonomyrmex barbatus (red harvester ant): 105427913Help
Entry
105427913         CDS       T04903                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105427913
Peptidases [BR:pbar01002]
 Metallo Peptidases
  Family M2
   105427913
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105427913
CD molecules [BR:pbar04090]
 Proteins
  105427913
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 709 aa AA seqDB search
MKFAFGGTGRMLDRISFAIWTAFVFYLITTVSGQLDLPPYRGEDVGRQVPYRGEDASRQD
SYTNEDVGRQVPSGELNYQNILAKLDFLGAERCSANVIAQWTYETNVNEYTQLQALDAQR
LYADFQYQAWLLISRIDINAIRDPIIRRRLRYLSAVGPSALPPDQLDRYNRLINDMLAIY
NAATICAYNDPFRCELRLYPDIAQIMARSRDWDELQYVWTEWRRRSGRPIRDLYQQLVTL
SNDAARMNNFTDAAEYWMFPYESPNFQQDIDEAWESIRPLYEELHAYVRKKLRDLYGPEK
IGGHAPLPSHILGNIWGQSWTNLLDVTLPYPGKIYPDVTQEMRAQGYTPIDMIRVAEEFY
LSLNLSAMPPEFWAGSIIADPGDRPLICQASAWDFCNRIDYRIKMCTKVTMKDLITLHHE
MGHIQYFLRYSGLPREFRDGANPGFHEAVGETVALSVATPQHLQTLGLANRYIDEHSADI
NYLFSLAMDKLVLLPFSIAIDRWRWDVFRGYVNKEEYNCHWHRLKEQYTGTKPPVLRSED
DFDPGAKYHIPANIPYIRNFVAGILQFQLYRALCQAAGQRYGIDNPRRPLHRCDFYRRPE
AGRILGRLMERGSSIPWQETLREATGEARLDGSALREYFRPLEDWLRTENLRTGEVVGWS
YDGDFCKRSIETAGLQVYGSGFYNSGVSISASWIASGTMMIFWIISTFY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgctttcggtggaaccggtagaatgttggaccgcatcagttttgcaatatgg
acagcattcgtattttatctaataacaacagtttctggtcaattggatttgccaccgtat
aggggtgaagatgtaggccgacaagtgccgtacaggggtgaagatgcaagccgacaagac
tcatacacgaatgaagatgtaggacgacaagtgccttccggtgaattaaattatcaaaat
atcttagctaaattagatttccttggcgcagaaagatgtagtgctaatgtaatagcccaa
tggacatacgagaccaatgtcaacgaatatacgcagctgcaagcgctggatgcccaacgt
ctgtatgcagacttccagtaccaggcttggcttttaatctccagaatcgacataaatgcc
attcgagatcccataattagacgacgactccgttatttatccgccgtgggtccctcggcg
ctgccgcccgatcaactagacaggtataatcgcctgatcaacgatatgctcgcgatttat
aacgcggcgaccatatgcgcttacaacgatccgttccggtgcgagctacgtttatatcca
gacatagcgcaaattatggcgagaagtcgggattgggacgaactgcagtacgtctggaca
gaatggagaagacgaagcggcaggccgattagagatctatatcaacaactcgttacgctg
agcaatgatgctgcaagaatgaataacttcactgatgccgccgagtattggatgttccct
tatgaatctcctaatttccaacaagatattgacgaggcttgggaatcgatacgtccactt
tacgaagaattgcacgcttatgttcgtaagaagctgagagatctctacggtcctgaaaag
atcggcggacacgcgcctcttccgtctcatattcttggtaatatatggggacagtcttgg
accaatctcttggatgttactttgccatatcctggaaaaatatatcctgatgttacgcag
gaaatgcgagctcaaggttatacacccattgacatgattcgagtagccgaggaattctat
ttgtccttaaacttaagcgccatgccgccagaattttgggctggaagtataatcgcagat
cccggggatcgtccattaatctgtcaagcgtctgcgtgggacttctgcaatcgtatagac
tacagaatcaaaatgtgcacaaaagtgacgatgaaggatttaataactttacatcacgag
atgggacacatccagtacttcctgcggtacagcggtttacctcgcgaatttcgcgacggc
gctaatccagggttccatgaggcggtcggcgaaaccgtcgccttgagcgtcgcgacgccg
cagcatttgcaaactctgggcttggcgaatagatacatcgacgaacactctgcggacatt
aattatctcttctccttggcgatggataaactggtattattgcccttcagcatcgcgata
gacaggtggcgatgggatgtcttccgcggctatgtcaataaggaggaatacaattgccat
tggcacagactcaaggaacaatacacgggtaccaaaccgccggttctacgatccgaggat
gacttcgatccaggtgcgaagtatcacatcccggccaatattccctacatacggaatttc
gtggctgggatcctccaatttcagctgtatcgcgcgctgtgccaggctgcaggacagagg
tacggaatcgacaatccgaggaggccgttgcacagatgcgacttttacagaagacccgag
gccggcagaatcttagggagattgatggagagaggttcgtccatcccgtggcaggaaacg
ttgcgagaagccaccggtgaagctagattagacggatccgctcttagggaatacttccgg
ccattggaggactggttgaggaccgagaatttgagaacgggagaagtagtcggctggtca
tacgatggtgacttttgcaaaaggagtatagagaccgctggcctgcaagtttatggtagc
ggcttctataatagtggcgtatctatttccgcatcttggatcgcgagcggaaccatgatg
attttttggattatatcaacattctattga

DBGET integrated database retrieval system