KEGG   Pogonomyrmex barbatus (red harvester ant): 105429546Help
Entry
105429546         CDS       T04903                                 

Definition
(RefSeq) annulin isoform X1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
Enzymes [BR:pbar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105429546
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 757 aa AA seqDB search
MYPAYRSYPQPVQPLHPDRRGMFYRFYDRYRIFNDRRVRPFPFRFYWEDFGVPVLTIHNV
DPCIEENGENHRTSRYELMTRQDDRARLVVRRGQEFYLHLSLSRDYNSSIDGISMVFTLD
GIEKPQYGHGTLVATALLYPGEISEAAWQTTIDARGPHFLRIKVVTSPNAIIGRWKIDID
TKNKESEGAVSYTMDHPFYLICNPWCTDDVVYLDDEAERQEYVMAEDGLIWRGSHNRLRP
TVWKYAQFERDILDCALHLMNYVGKVRVSGRNDPVIITRCLSAAVNSPDDNGALMGNWSD
DYGGGTPPTRWMGSQKILQQYYKTKKPVKYGQCWVFSGVLATICRTLGIPCRVVTNYSSA
HDTQSSLTVDYFVNAEGKLMEELNSDSIWNFHVWNEVWMKRLDLSPDCSGWQAIDATPQE
LSEGAYRCGPASVAAVKKGEVLRPYDNAFLFAEVNADKVFWRYNGPTQPLKLVRKDMHGI
GQLISTKAVGRWTREDITHTYKYPEKSDEERAAMLKALRQSESLFSRYYLNEEFNDVMFT
FELRDDIIIGQPFSVVLLIKNRHSTMEYHVSAILRVETVLYTGRVGDPVKRLHVNRLVRP
GVLEEIRMDVSWEEYGPRLLDQCAFNISCLATVKDTNFEYFAQDDFRVRKPDIKITLHNE
AVIDQTLNASAKFRNPLPIPLRKGRFLIEGPGLDEQLKLKLSEPVEVDADAECTFSMMPK
LEGRARIAAKFYSRELEDVDGHSDNFIVKPAKIVNSE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtatccagcctatcgttcgtatccgcagccggtgcagccactgcatccggaccgtcgc
gggatgttttacagattctacgatcgctatcggatattcaatgatcgacgtgtccgaccg
tttccgttcagattctactgggaggatttcggcgttccggtattgacaatccacaatgtg
gatccttgcatcgaagaaaacggcgagaatcatcggacatccagatacgagctgatgacc
cgtcaggatgacagagcgagactcgtcgtgagacgtggccaggaattttatctgcacctg
agtctatctcgagactataattcttccatcgacggtatttctatggtctttactttggac
ggcatcgagaagccgcaatatggacacgggacactggtggcaaccgctcttctctatccc
ggagagatttccgaagctgcttggcagaccaccatagacgccagaggaccgcatttctta
agaataaaggttgtgacgtccccaaacgcaattataggcagatggaaaatagatatcgat
accaaaaacaaggaatccgaaggtgctgtcagttacacgatggatcatccgttttacctg
atctgtaatccatggtgcacagatgacgtggtatatttggatgatgaggccgaacgtcaa
gagtatgtaatggcggaggacggtttaatctggcgcggcagtcacaatcgtttacgaccc
actgtgtggaaatacgcgcaattcgaacgtgatattttggattgtgccttgcacctgatg
aactacgttggcaaggtccgcgtctccggcaggaatgatccggtcatcataacgcgttgt
ttatccgccgcggtgaactcccctgacgacaatggggcgctgatgggaaattggtcggac
gattacgggggcggcacaccacctaccagatggatgggctcgcagaaaatactccagcaa
tattacaagacgaagaagccggtcaaatacggacagtgctgggttttctccggtgtactg
gcgacgatttgtcgtactcttggtataccttgtcgagtagtgaccaactattcgagcgcg
catgatactcagagcagcttgaccgtggattactttgtgaatgccgaaggcaagcttatg
gaggagctcaacagcgattctatatggaatttccacgtctggaacgaagtgtggatgaag
cggttggatttgtcgccggattgttcgggatggcaggctatcgatgcgactcctcaagaa
ctgagcgaaggcgcgtatcgttgcggaccggcatcggtggctgccgtaaaaaagggagaa
gtcctgcgtccgtacgacaacgcgttcctcttcgccgaggtgaacgccgataaagtcttt
tggcgttacaatgggcccacgcaacccttgaaattagttcgcaaggatatgcatggcatc
ggccagctgatcagcacgaaagcagttgggagatggacgagagaggacatcacgcatacc
tacaagtatccagaaaagtctgatgaagaacgtgctgccatgttgaaagcattgcgccag
agcgaatctttatttagccgttattatctcaacgaagagttcaacgatgtcatgttcact
ttcgaactgcgcgatgacattataattggacagccatttagcgttgtattattgataaaa
aatcgacattcaacgatggagtatcacgtatccgcaattctgagagtggaaacagtatta
tatactggccgggtaggtgatccggtgaaaagattgcacgtcaatagactagttcgacct
ggtgtgctcgaggaaattcgcatggacgtttcctgggaggaatacggtccgagattattg
gatcaatgtgctttcaatatctcctgtctcgctaccgtgaaggacacgaacttcgagtat
tttgcacaggacgattttcgcgtcaggaaaccggatattaaaattacgttacataatgaa
gcagtcatcgatcaaaccctcaatgcttcggccaaatttcgcaatccactacctattcct
ttgaggaagggtaggtttcttatcgaggggcctggtctggacgagcagttgaagttaaag
ttgtcggagcctgtcgaagtggatgcagacgcggaatgtaccttttccatgatgccaaaa
ttggaaggtcgtgctaggatagcggcaaagttttattccagagaactggaagacgtcgat
ggacattcggataattttatagtcaaaccggcgaaaatagtcaattctgagtga

DBGET integrated database retrieval system