KEGG   Pseudomonas brassicacearum DF41: CD58_09240Help
Entry
CD58_09240        CDS       T03174                                 

Definition
(GenBank) peptide synthase
Organism
pbc  Pseudomonas brassicacearum DF41
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2022760..2035746
Genome map
AA seq 4328 aa AA seqDB search
MTDAFELPSTLAHALQRRAALTPDRVALRFLADTPEQGVVLSYRDLDLGARTIAAALQAE
AAFGERAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLL
LTSSDLRAPLQAIESAPPVLCVDTLDPAIAGQWVLPTLQDDDIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPVFSGVPCVLMSPAY
FLARPLRWLEAISEYGGTISGGPDFAYRLCSERVSDSALARLDLSGWRVAYSGSEPIRLD
TLERFAEKFAPCGFTPDNFMASYGLAEATLFVAGTPRRHGIPSLRVDDAALAQNRAESGQ
GSAMMSCGVSQPGHAVLIVEPNTLQALADNRVGEVWATGPSIAHGYWHNPEATAKTFVLH
DGRTWLRTGDLGFLRDGELFITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAF
AVDEGGEEGIGIAAEISRSVQKILPPEALIRAIRQAVAEACQQAPSVVVLLNPGALPKTS
SGKLQRSACRSRLADGSLDSYALFPSAEREDTREAGPSSALQTLIGQVWCEHLQVEQVQA
DDHFFLLGGNSIAATQVIARLRDQLGLALNVRLLFEAPTLAAFAAAVASQQQDGDQAQGA
ISVLPRHEALPQSLAQNRLWITWRLDPASRAYNIPGALHLRGELDEDALRASFQQLVERH
ESLRTRFLERDGVALQQVDPAAGFNLQVLDLSEVPADQREARARQVRDEDAATPFDLEKG
PLLRVTLLRLDEDDHQLLVTLHHIIADGWSMNVLIEEFSRLYAAARQGQVAELAPLPLQY
ADYGSWQRQWLAQGEAERQRVYWKQQLGGEHPTLALSTDHPRSAQHHRSAARHSLRLDKG
LGDALRRVAQAHDATLFMLLLAAFQALLQRYTGQSDIRIGVPNANRPRLETQGLIGFFIN
TQVLRGQVDPRQAFTALLAQAREATLGAQAHQDLPFEQLLEAFPQAREHGLFQVMFNHQQ
RDLGALRRLPGLLADELPWHSREAKFDLQLHSEEDRNGRLTLSFDYADELFETATIARLA
EHYCNLLRAVCVDPQQAIGDVPLLTAEEHARQQQWSGAPCAPASQWLPELLNEQARRTPQ
RTALLWDGGQLDYAELHSQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGVLAIIKAGG
AYVPLDADYPAERLAYMLQDSGVDLLLTQTGLLERLPACEGVSVIAMDALHLEQWPSNPP
GLHLHGEHLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQAAYGLDESDVLMQKAPISFD
VSVWECFWPLITGSQLLLAGPGEHRDPHRIAQLVQQFGVTTLHFVPPLLSLFIDEPLSAR
CTSLRRVFSGGEALPAELRNRVLAQLPSAQLHNRYGPTETAINVTHWHCSEADGERSPIG
RPLGNVLCRVLDSELNPVPAGVSGELCIGGLGLARGYLGRPGLSAERFVADPMGAAGARL
YRTGDRARWTADGVIEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGIAQVAVLVRDTAAG
PQLIGYYTAPDVAEDQDALNTRLNAALAAELPDYMVPAQLLRLGTMPLSPSGKLDRRALP
EPQWQVREHVEPVSALEQQIAGIWRDVLGLARIGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRTLFEASELGAFCEQVRLIQASGQTNRQPPIATVDRSQPVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLDVGRFEAALMALILRHETLRTTFPSVDGVARQQVHTETGL
RMDWKDFSRLAADVREQRVQQLADSEAHKPFDLETGPLLRACLVKTAEQEHYLVLTLHHI
VTEGWAMDIFARELSALYEAFIDDRESPLEPLPVQYLDYSVWQRQWLESGERQRQLDYWT
AQLGREHPLLELPSDRPRPPVQSHRGELFRFDLSDDLAARVRHFNAEQGLTLFMTMTAAL
AVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLVNDA
RATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALLADPARRLSELP
LLEAGEQQQMLDSLGVEPGEHRLDQCLHELFGEQARGRLDAPALTFAGQTLTYGELDNRA
NRLAWMLRERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIED
SGVGLLISDRAMFQALGPLPDGIERWCLEDDSAALAHYPDQALPLINLPQHQAYLIYTSG
STGKPKGVVVSHGEIAMHCQAVIRRFGMRPDDCELHFYSINFDAATERLLVPLLSGAHVV
LRAQGQWDAEEICELIRQHRINILGFTPSYGSQLAQWLATQGQTLPVRMCITGGEALTGE
HLQRIRAAFSPSLFFNAYGPTETVVMPLASLAPEHLEEGAASVPIGSVIGARVAYILDAD
LALVPQGATGELYVGGAGLAQGYHQRPGMTAERFVADPFAAEGGRLYRTGDLVRQRADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLEHDGVREAVVLALDTPGGKQLAGYLVTEVAEQ
DAEQQAALRDALKNHLKAQLPDYMVPAHLILLASMPLTANGKLDRRALPMPDPEFNRQHY
VAPSNALEQTLATIWCDVLNVGQVGLNDNFFELGGDSILSIQVVSRARQQGIHFTPRDLF
QHQTVQTLAAVATHSQQISVEQGLLHGESGLTPIQHWFFDSPIPNRHHWNQALLLEPAIT
LDPLALEQALHAVFQHHDALRLGFDESAGHWRAEHRPLSEAALLQQVSVEGVETCERVFA
EAQRSLDLSTGPLLRAVLAQMPGGPQRLLIVIHHLVVDGVSWRVLMDDLQTVYRQLTAGQ
DAQLPAKTSPLRDWAARLQAYASSESLREELDDWQAQLSGPQVTLPCARPEGGCQERHAQ
TLSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRSSGHASALVQLEGHGREALF
DDIDLTRTVGWFTSVYPVRLSPSGEDFSASIKAIKEQLRAVPHKGLGYGVLRYLTDPATR
QAMAGLPQAAITFNYLGQLDQTLGQDALFRPLDAPLGAIHDPDAPLPNDLSIDSQVSGGE
LVLRWTFSRERHDKQVIAALADAYLDELQRLIEHCLTEEAGGLTPSDFPLAKLTQDQLDN
LPVPAAQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELEPQRFAQAWQAVIA
RHEALRASFCWNVGEDMLQIIHKPGSTPVDYLDWSEVPEDAQEAKLQTLLKDEREAGFDL
LNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMDDFFEIYTALGEQREAQLAVPP
RYRDYIGWLQHQSLAEARQWWKGNLQGFERTTPIPGDRPFLREHAGDSGGMIVGDCYTRL
DVRDGARLRELAQAHQLTINTFAQAAWALVLRRVSGDRDVLFGVTVAGRPVELPQMQRTV
GLFINSVALRVQMPEDSQPCSVRQWLSGLLDSNMQLREYEYLPLVSIQEVSELPKGQPLF
DSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDE
STVQGLLGEFKRLLLALMEGFHGDMAELPLIGAEEQVFLVDGCNQSERAYPMEQSYVALF
ESRVAAHPQRIAVSCLDTCYSYAELNARSNRLGHALIASGVGLDQPVALLAERDADLLGM
IIGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCTQACHAQALALLDAFACSGRPRV
LVWEDVQASDVSLENPGVYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLA
LSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLEHVQQQGITVLES
VPSLIQGMLAQERIGLDGLRWMLPTGEAMPPELAHQWLLRYPDIGLVNAYGPAECSDDVA
FFRVDMASTRGTYLPIGTPTDNNRLYLLDGALDLVPLGAVGELCVAGTGVGRGYVGDPLR
TAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIELGEIEARLHE
QPEVRDGAVAVQEGTNGKHLVGYLVATDSALKPSERLERIKQRLRSELPEYMVPLHWLWL
DRLPLNANGKLDRKALPALEIGQLHSQDYQAPGNALEQTLADIWAQVLKVERVGVRDNFF
ELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVQELAEYIDGLAASDITEEKVDRLND
LMAELEGL
NT seq 12987 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgtttgaactccccagcaccctggctcacgccctccagcgccgcgccgcg
ttgacgccggaccgagtggccttgcgcttccttgccgacaccccggagcagggtgtggtg
ttgagttatcgcgacctggacctgggcgcccggaccatcgccgccgccttgcaggccgaa
gcggcatttggcgagcgcgcggtgttgctgttccccagcggcccggattacgtcgcggcg
ttttttggctgcctctacgctggggtgatcgccgtgccggcctatcctccagagtccgcc
cgtcgccatcatcaggaacgcctgctgtcgatcatcgccgacgccgaaccgcgcctgctg
ctgaccagcagcgatctgcgcgcgcccttgcaagccatcgagtcggccccgccggtgttg
tgcgtcgacaccctcgacccagccatcgccgggcaatgggtgttgccgacgctgcaagac
gatgacatcgccttcctgcaatacacctccggctccaccgcgttgcccaagggtgtgcag
gtcagccacggcaacctggtggccaacgaattgttgattcgccacggctttggcatcgac
ctgaaccccgacgacgtgatcgtcagctggctgccgctgtaccacgacatgggcttgatt
ggcggcttgttgcagccggtgttcagtggcgtaccgtgcgtgctgatgtcgcccgcgtat
ttcctcgcccggccactgcgttggctcgaagcgatcagcgagtacggcggcaccatcagc
ggcggcccggatttcgcctatcggttgtgcagcgagcgcgtcagcgattcagccctggcg
cgtcttgatctgagcggctggcgcgtggcctattccggctccgagccgatccgcctcgac
accctggagcgcttcgccgagaagttcgccccgtgcggcttcacgccggacaacttcatg
gcttcctatggcctggccgaagcgacgttgttcgtggccggcacgccgcgccgccatggc
attccttcgctgcgggtggacgacgcggcactggcgcaaaaccgcgccgagtcggggcag
ggcagtgcgatgatgagttgcggtgtcagccagcccgggcacgcggtgttgattgtcgag
cccaataccttgcaggcgctggcggacaatcgggtcggcgaagtctgggccaccgggcca
agcatcgcccacggctactggcacaaccccgaggccacggccaagacctttgtcctgcac
gatggccgcacctggctgcgcaccggcgacctggggttcctgcgcgacggtgagctgttc
atcaccgggcgcctgaaggacttgctgatcgtgcgtggtcacaacctttatccccaggac
atcgagcaaaccatcgaacgcgaagtggaggtggtgcgcaaaggccgggtggcggcattc
gcggtcgatgaggggggcgaggaaggcattggcatcgccgcggaaatcagccgcagcgtg
cagaaaatcctgccgcccgaggccttgatcagagccattcgccaagctgtggccgaggcc
tgccagcaagccccgagcgtggtggtgctgctcaatcccggcgcgttacccaagacttcc
agtggcaagttgcagcgttcggcctgccgttcccgattggcggacggcagtctcgacagt
tatgcgctgttcccgtcggccgagcgtgaggacactcgtgaggcgggcccatcatcggcg
ctgcaaacgctgatcggccaagtctggtgcgagcacttgcaggtcgaacaggtccaggcc
gacgatcacttcttcctgctgggcggtaactccatcgccgccacccaagtgatcgcgcga
ctgcgggaccagctgggtctggcgctcaatgtgcgcctgctgttcgaagccccgaccctg
gcggctttcgcggcggcggtggcgagccagcaacaggacggcgaccaggcccaaggcgcg
atcagcgtcttgccgcgccacgaagcgctgccgcaatccctggcccagaaccgtctgtgg
atcacttggcggctcgatcccgccagccgcgcctacaacattcccggcgccctgcatttg
cgcggtgagctggacgaagacgctttgcgcgccagcttccaacaactggtcgagcgccac
gaatccctgcgcacgcggttcctggaacgtgatggggtggccctgcaacaggtcgatccg
gctgctgggttcaacctgcaagtgctcgacctcagcgaggtgcctgccgaccagcgcgaa
gcccgggcgcggcaggttcgagacgaggacgcggccacgccgttcgacctggaaaagggg
ccgctgctgcgggtcaccttgctgcgcctcgatgaagacgatcatcaactgctggtgacc
ctgcaccacatcatcgccgacggctggtcgatgaatgtgttgatcgaagagttctcgcgg
ctgtacgccgccgcccgccaagggcaggttgccgagctggcgccgctgcccttgcaatac
gccgactacggcagctggcagcgccaatggctggcccaaggggaggccgaacgccaacgg
gtgtactggaaacagcaattgggtggcgagcatccgaccttggccctcagcacggatcat
ccgcgcagtgcacaacaccatcgcagtgccgcgcgtcatagcctgcgcctggacaaaggc
ctcggcgatgccttgcgtcgagtggcccaggcccatgacgcgacgctgttcatgctgttg
ctggcggcgttccaggcattgttgcagcgctataccggccaatccgacatccgcatcggt
gtgcccaacgcgaaccgtccgcgcctggaaacccagggtctgatcggtttcttcatcaac
acccaggtgctgcgcgggcaggtcgatccgcggcaagcgttcaccgcgctgctggcccag
gcccgggaagccaccctcggtgcccaggcccatcaggacttgccgttcgaacagttgctc
gaagcgtttccccaagctcgggagcatggcctgttccaggtgatgttcaaccaccagcaa
cgtgacctgggggccttgcggcgcctgccggggttgttggccgatgagttgccatggcac
agccgcgaagccaagttcgacctgcaactgcacagcgaagaggatcgcaacggccggctg
acgctgtcgttcgactacgccgacgagctgttcgagacggcgactatcgcccgcctggcc
gagcattactgcaacctgttgcgcgccgtttgtgtcgatccccaacaagccatcggcgat
gtgccgttgttgaccgccgaggaacatgcgcggcagcagcagtggagcggggccccgtgt
gcgccggccagccagtggttgccggaactgttgaacgaacaggcccggcgcacgccacaa
cgtaccgccctgctgtgggacggcgggcagctggactacgccgagctgcactcccaggcc
aatcgccttgcccattacctgcgcgacaaaggcgtcggcccggacgtgtgcgtggcgatt
gccgccgaacgctcaccgcagttgctcatcggcgtgctggcgatcatcaaggccggtggc
gcctacgtgccgctggatgccgattacccggctgagcgcttggcctacatgctccaggac
agtggcgtcgatttgctgctgacccaaacggggttgcttgaacgtttgccggcctgcgag
ggcgtcagcgtcatcgccatggacgccctgcatctggagcaatggccgagcaatccgccg
ggcttgcacctgcacggcgagcacctggcctacgtgatttacacctccggttccaccggc
cagcccaagggcgtcggcaacacccacgccgccctggccgagcgcctgcaatggatgcag
gccgcctacgggttagatgaaagcgatgtgctgatgcaaaaagcccccatcagttttgac
gtgtcggtgtgggagtgcttctggccgctgatcaccggcagccaactgctgctcgccggc
cccggtgaacatcgcgacccgcatcgcatcgcccagttggtgcaacagttcggcgtgacc
acgctgcacttcgtgccgccgctgctcagcctgtttatcgacgaacccttgagcgcccga
tgcaccagcctgcgccgggtgttttccggcggcgaagccttgccggccgagctgcgcaac
cgcgtgctggcgcaactgccgtcggcgcaattgcacaaccgctatggcccgaccgaaacc
gcgatcaacgtcacccattggcactgcagcgaggccgatggcgaacgctcgccaatcggc
cgtcccctgggcaacgtgctgtgccgtgtgctcgacagcgaactcaacccggtaccggcc
ggtgtgtcgggcgagttgtgcatcggcggcctgggcctggcccggggttacctcggccgt
ccgggcctgagcgccgagcgtttcgtcgccgatccaatgggggcggccggggcgcggctg
taccgcaccggcgaccgggcccgctggaccgccgacggtgtgatcgaatacctcggccgt
ctcgatcagcaggtcaagctgcgcggttttcgggtcgaaccgcaggaaatcgaagcgcgc
ctgttggcccaggacggcatcgcccaagtggcggtgctggtacgcgacaccgcagcgggc
ccacaactgatcggctattacaccgcccccgatgtggcggaggatcaggacgcgctgaac
acccgactcaacgccgccctggccgccgaactacccgactacatggtgcccgctcagtta
ctgcgcctgggcaccatgcccctgagcccgagtggcaaactcgatcgccgtgccttgccc
gagccgcagtggcaggtgcgtgagcacgtcgagccggtcagcgcccttgagcagcagatc
gccggcatctggcgcgacgtattggggcttgcgcgcatcggcctgcgggacgatttcttt
gccttgggcggccattcgctgctggcgacccagatcatttctcgcacccgccaggcgtgc
gacgtcgagctgccgttgcggacgttgttcgaggccagtgaactgggggcgttctgcgaa
caggtgcgcttgatccaggccagcggccagaccaaccggcagccaccgatcgccacggtc
gatcgtagccaaccggtgccgctgtcgtattcccagcaacgcatgtggtttctctggcag
atggagccggacagtccggcctacaacgttggcggcatggcgcgcctgcgcggggtgctg
gatgtcgggcgcttcgaagcggccttgatggcgttgatcctgcgccacgaaaccctgcgc
accaccttccccagcgtcgacggcgtggcccggcaacaggtgcacaccgaaacgggccta
cgcatggactggaaggacttctccaggctggccgccgatgttcgcgagcagcgagtgcag
caattggccgacagcgaggcgcacaagcccttcgacctggaaaccgggccgctgctgcgg
gcctgcctggtcaagaccgccgagcaggaacattacttggtgctgaccctgcaccacatc
gtcaccgaaggctgggcgatggacattttcgcccgcgaactgagcgcgctctacgaagcc
tttatcgacgatcgcgaatcgcccctggagcccttgccggtgcaatacctggactacagc
gtctggcagcgtcagtggctggaatccggtgagcgtcaacggcaactggattactggacc
gcgcaactgggccgcgagcatccgctactggaattgccgagcgaccgtccgcgtccgccg
gtgcaaagccaccgcggcgaactgttccgtttcgacctcagcgatgatttggccgcgcga
gtccgccacttcaacgctgaacagggcttgaccctgttcatgaccatgaccgccgccttg
gccgtgctgctctatcgctacagcggccaaaccgacctgcgcatcggcgcgccggtggcc
aaccgcatccgcccggaaagcgagggcctgatcggcgcgttcctcaacacccaggtattg
cgttgccagctcgacgggcaaatgtcggtgggcgaactgttcgagcaggtgcgccatacc
gtgatcgaaggccagtcccatcaggacctgccgttcgatcatctggtggaagccctgcaa
ccgccgcgcagtgcggcgtacaacccgctgttccaagtgatgtgcaacgtgcagcgttgg
gagttccagcagagccgtacgctggctggcatgaccgtcgaatacctggtcaacgacgcc
cgggccaccaagttcgacctgaacctggaggtcaccgacctggaccatcgcctgggttgc
tgcctgacctacagcaccgacctgttcgacgaaccgcgcatcgcccgcatggccgggcac
tggcgcaatctgttggaagcgctgttggccgatcccgctcgacggttgagcgagctgcct
ctgctggaagccggcgagcagcaacagatgctcgacagcctgggtgtcgaacccggtgag
catcgcctggaccaatgcctccacgaactgtttggcgaacaagcccgggggcgtctcgac
gcaccggccttgaccttcgccgggcagaccctgacctacggtgaactcgacaaccgagcc
aatcgcctggcctggatgttgcgcgaacgcggtgtcgggccgcaggtgcgggtgggcctg
gccctggagcgttcgctggaaatggtcatcggcctgctggcgatcctcaaggccggcggc
gcctacgtaccgctggacccggagtacccgctggaccgtttgcattacatgatcgaagac
agcggtgtagggctgctgatcagtgatcgggcgatgttccaggccttggggccattgccg
gatggcatcgagcgctggtgcctggaagatgattcggcggcactggcgcattacccggac
caggcactgccgctgatcaatctgccgcaacaccaggcctacctgatctacacctccggt
tccaccggcaagcccaagggcgtggtggtgtcccacggtgaaatcgccatgcactgccag
gcggtgatcaggcgtttcggcatgcgcccggacgattgcgagctgcatttctattccatc
aacttcgacgctgccaccgagcgtctgctggtgccgttgctcagtggcgcccacgtggtg
ctgcgggcccagggccagtgggacgccgaggaaatctgcgagctgattcgccaacatcgc
atcaacatcctcggcttcacccccagctacggcagccagttggcgcagtggctggcgacc
caggggcagaccctgccggtgcgcatgtgcatcaccggcggcgaagccttgaccggtgag
cacctgcaacggattcgcgccgcgttcagcccgagtctgttcttcaacgcttatggcccg
accgaaaccgtggtcatgccgctggcgagcctggccccggagcacctggaggagggggcg
gccagtgtgccgattggcagtgtgatcggtgcccgggtggcctacattctcgacgccgac
ctggccttggtgccccagggcgccacaggcgagttgtatgttggcggcgccggattggct
caggggtatcaccagcgtccgggcatgaccgccgagcgtttcgtcgccgacccgtttgcc
gccgagggcgggcgcctctatcgcaccggggacctggtgcgtcagcgtgccgacggtctg
gtggagtacctgggacggatcgaccatcaggtgaagatccgtggtttccgcatcgaactg
ggggaaatcgaaacccgcctgctggaacacgacggggtgcgcgaggcggtggtgttggcc
ctcgacacgccagggggcaagcaactggccggttacctggtgaccgaggtcgccgagcag
gatgccgagcaacaggcggccctgcgcgacgccttgaaaaaccacctcaaggcacagctg
cccgactacatggtgcccgcgcacctgatcctgctggcgagcatgccgctgaccgccaac
ggcaagcttgaccgccgcgccttgccgatgccggatcctgaattcaatcgtcaacactac
gtggcgccgagcaacgccctggagcagaccctggcgacgatctggtgcgatgtgctgaac
gtgggccaggtgggccttaacgacaatttcttcgagctgggcggtgattcaatcctgtcc
atccaggtggtcagccgtgcccggcagcagggcattcatttcactccccgcgacctgttc
cagcaccagaccgtacagaccctggccgctgtcgctacccacagccagcagataagcgtc
gagcagggcctgttgcacggggaatccgggctgacgccgatccagcattggttcttcgac
agtccgatccccaaccgtcatcactggaaccaggcgctgttgctggagccggccatcact
ctggacccgttagctctggagcaggcactgcacgccgtcttccaacaccacgatgccttg
cgcctgggctttgacgagtccgccgggcactggcgcgccgagcatcggccattgtccgag
gcggcgctgttgcaacaggtgtccgtggagggcgtggagacctgtgagcgtgtattcgcc
gaggcccagcgcagcctggatctttctaccggccctctgctgcgtgccgtgttggcgcag
atgcctggtggaccacaacggctgctgatcgtcattcatcacttggtggtcgacggggtg
tcgtggcgggtgctgatggacgatctgcaaaccgtctaccgtcagctcacggccgggcaa
gacgcccaactaccggccaagaccagtccgttgcgtgactgggccgcgcgcttgcaggct
tacgccagcagcgaatccctgcgcgaagaactggatgactggcaagcgcaattgagcggc
ccgcaggtgacgttgccgtgtgcgcgccctgagggtgggtgccaggagcgtcacgcgcaa
acgctcagcgtgcgcctcgacgccgagcgcacccggcagctgctgcaacaggccccgagt
gcctaccgcacccaggtcaacgacctgttgctcacggcgctggctcgggtgctgtgtcgt
tcaagcggccatgcttcggccttggtccagctcgaaggccatggccgcgaggcattgttc
gatgacatcgacctgacccgcaccgtgggctggttcaccagcgtttatccggtgcgcctg
agcccatcgggtgaagacttcagcgcgtcgatcaaggccatcaaggagcaactgcgcgcg
gtgccccacaagggcctcggctatggcgtgctgcgctatttgactgacccggcgactcgc
caggcaatggccggcctgccgcaagcggcgatcaccttcaactacctcggtcaactggac
cagaccctcggccaggacgcgctgttccggccgctggatgcaccactgggcgccatccac
gaccctgacgcgccattgcccaacgacctgagcatcgacagccaggtcagcggcggcgag
ctggtactgcgctggaccttcagccgcgaacgccatgacaagcaggtcatcgctgccttg
gccgatgcttacctcgatgagctgcaacgcctgatcgaacattgcctgacggaggaggcg
ggcggcctgacgccgtcggatttccccctggcgaaactgacccaggaccagctcgataac
ctgccggtgccggccgcgcagatcgaagacgtctacccgctgacgccgatgcaggaaggc
atgctgctgcacaccctgctggagccgggcaccggcctgtactacatgcaggatcgctac
cgcatcaacagcgagctggagccgcagcgtttcgcccaggcctggcaggcggtcatcgcc
cggcatgaagccttgcgtgcgtcgttctgctggaacgtcggcgaagacatgctgcagatc
atccacaagcccggcagcacgccagtggattatctggattggtctgaagtgcctgaagac
gcccaggaagccaagcttcagacgctgctcaaagacgagcgcgaggccggtttcgatctg
ttgaaccaagcgccgttccacctgcgattgatccgggttggcgcagcccgctactggttc
atgatgagcaaccaccacatcctgatcgatgcctggtgccgctcgctgctgatggatgat
ttcttcgagatctacaccgccctgggcgaacagcgcgaggcgcaactggccgtgccgccg
cgctatcgcgactacatcggctggctgcaacaccagagcctggccgaagcccggcaatgg
tggaagggcaatctgcaaggcttcgagcggaccacgccgatccctggcgaccggccgttc
ctgcgcgaacacgccggtgacagcggtggcatgatcgtcggcgactgctacacccgcctc
gacgtacgtgacggtgcccgcttgcgcgaattggcccaggcccaccaactgaccatcaac
actttcgcccaggcggcgtgggcgctggtgctacgacgggtgagcggcgaccgggacgtg
ctgttcggcgtcaccgtcgccgggcgtccggtggaactgccgcagatgcaacgcacggtg
gggttgttcatcaacagcgtcgcgctgcgggtgcagatgcccgaggacagccagccttgc
agtgtgcgccaatggctcagcggcttgctggacagcaacatgcaactgcgcgagtacgaa
taccttccactggtgagcatccaggaagtcagtgaactgcccaagggccaaccgctgttc
gacagccttttcgtgttcgagaacgcgccggtggaagtctcggtactggaccgcgcccaa
agcctcaacgccacctcggactcgggccgcacccacaccaacttcccgctgacggcggtc
tgctacccgggggatgacctgggactgcatctttcctatgaccagcgctactttgatgag
tccaccgtccaagggctgctgggcgagttcaagcgcttgttgctggcgctgatggagggt
ttccacggtgacatggccgagctgccgctgattggcgccgaggaacaggtgttcctggtc
gacggctgcaaccagagcgagcgggcctatccgatggagcagagctatgtcgcgctgttc
gagtcgcgggtcgcggcccatccgcaacgcatcgccgtcagttgtctggacacctgctac
agctatgccgagttgaatgcccgcagcaaccgcctgggccatgccttgatcgcctccggt
gtcgggctcgatcaaccggtggcgctgctggccgaacgggatgcagatctactgggcatg
atcatcggcagcttcaaggccggcgccggttacctgccgctggaccccggcctgccgagc
cagcgcctgagtcgcatcatcgaactgagccgcacaccgctgctggtctgcacccaggcc
tgtcacgcccaggcgctggcgctgctggatgcgttcgcctgttccgggcggccgagggtg
ctggtgtgggaggacgtccaggccagtgatgtctcgctggaaaaccctggcgtctacagc
ggcccggacaacctggcctacgtgatctacacctccggttccaccgggctgcccaaaggc
gtgatggtcgaacagcggggcatgctcaacaaccagctcagcaaggtgccttacctggcg
ctgagcgaggcggatgtgatcgcgcagacggcgtcccagagcttcgatatttcggtctgg
cagttcctcgcggcgccgttgttcggcgcccgggtggacatcgtgcccaacgccatcgcc
cacgatccccaggggctgctggagcatgtgcagcagcagggcatcaccgtgctggaaagc
gtaccgtcactgatccagggcatgctcgcccaggagcgtatcggcctggacggcctgcgc
tggatgctgcccaccggcgaagcgatgccgccggaactggcccatcaatggttgctgcgc
tacccggacatcggcctggtgaatgcctacgggccggcggaatgctccgatgacgtggcg
ttcttccgggtcgacatggcctcgacccgcggcacttacctgccgattggcacgcccacc
gacaacaaccgtctgtacctgctcgatggcgcgctggacctggtgccgctgggcgccgtc
ggcgagttgtgcgtggcgggcaccggggttggccgcggttacgtcggcgatcccctgcgc
accgctccagtgttcgtgccgaacccgttcggcgcgccaggggagcggctgtaccgcacc
ggcgacctggcgcggcgccgtagcgatggagtgctggagtatgtcgggcgcatcgaccac
caggtgaagatccgtggctaccgcatcgaactgggggaaatcgaagcgcggctgcacgaa
caacccgaggtgcgcgatggtgcggtggctgtgcaggaaggcaccaatggcaagcatctg
gtgggctacctggttgccaccgactcggcgctgaagccgagcgaacgcctggagcgcatc
aagcaacgcttgcgcagcgagctgccggaatacatggtgccgctgcactggctatggctc
gaccgcttgccgctcaacgccaacggcaaactcgaccgcaaggccttgccggccctggag
atcggccagttgcacagccaggactaccaggcccccggcaatgcgctggagcagaccctg
gcggacatctgggctcaagtactgaaagtcgagcgggtgggggtgcgggacaacttcttt
gaactgggcgggcattcgttgctggcgacgcaaattgcctcgcgggtgcaaaaggccctg
caacgcaacgtaccgctgcgggcgatgttcgagtgcagcacggtgcaggaactggctgag
tacatcgacgggctcgcggccagtgacatcaccgaggagaaggtggatcggctgaatgat
ctgatggcggagttggaggggctgtag

DBGET integrated database retrieval system