KEGG   Pseudomonas brassicacearum DF41: CD58_29370Help
Entry
CD58_29370        CDS       T03174                                 

Definition
(GenBank) aldose epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00010  Glycolysis / Gluconeogenesis
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD58_29370
Enzymes [BR:pbc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CD58_29370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHL36728
UniProt: W8PS30
LinkDB All DBs
Position
6543359..6544258
Genome map
AA seq 299 aa AA seqDB search
MPTPHVEAVRLDELNGWRIRHGQAELLVTQQGAHILSYQVDGQPPLIWLNDQATFKAGKS
IRAGVPVCWPWFGNLTRNPDSVQAMRVTNDPATAHGLVRAMDWELKGIEAEGESLKVEFV
LPYPENGLSGWPHQVDLTLTIVMDEQLHIHLTSHNRGSETVSLSQALHSYFAVSDVRNVR
VEGVDGLNYIETLDDWKTVTQAGDLHFAGETDRIYLDTPPTLSIIDPQWERRIELTSSGS
RSAVIWNPWTERAKAFSDMADDGWQRMLCIETANVMDDVVTLLPEASHTLGVSICSKPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgccccatgtcgaagccgttagactggatgaactgaacggctggcggatccgc
cacggtcaggccgagttactggtgacccagcaaggcgcgcacatcctcagctatcaagtg
gacggccagccgccgctgatctggctcaacgaccaggccacgttcaaggccggcaagagc
atccgcgctggcgtgccggtgtgctggccgtggttcggcaacctgacgcgcaaccccgac
agcgtgcaggccatgcgtgtgaccaacgatccggccacggcccacggcttggtgcgggcg
atggactgggagttgaagggcatcgaagccgaaggcgaaagcctcaaggtggagttcgtg
ctgccctaccccgaaaacggcctctcgggctggcctcatcaggtggacctgacgctgacc
atcgtgatggacgagcaactgcacattcacctcaccagccataaccgtggcagcgaaacc
gtcagcctcagccaggcgctgcacagttacttcgccgtgagcgatgtgcgcaacgtgcgg
gtcgaaggggtggatggcttgaactacatcgagaccctggacgactggaaaactgtcacc
caggccggcgatctgcactttgccggcgagactgaccgcatctatctcgataccccgccg
acgctgagcatcatcgacccacagtgggaacgccggatcgaactgaccagcagcggttcg
cgctcggcagtgatctggaacccctggaccgaacgcgccaaggccttcagcgacatggcc
gacgacggctggcagcgcatgctgtgcatcgagacggcgaatgtgatggacgatgtggtg
acgctgttgcccgaggccagccataccctgggcgtgagcatctgcagcaagccgctctga

DBGET integrated database retrieval system