KEGG   Paenibacillus borealis: PBOR_05010Help
Entry
PBOR_05010        CDS       T03324                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pbd  Paenibacillus borealis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pbd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PBOR_05010
Enzymes [BR:pbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PBOR_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1135021..1137000
Genome map
AA seq 659 aa AA seqDB search
MQIGVDYYPEHWDESMWETDIKLMKETGVKIVRVAEFAWSRLEPEEGRFDFAWLDRALDL
FHKYGIQIVIGTPTATPPRWLTTAYPDVLPVFADGGVFHPGVRGHRCYNSVSLRKYGSRI
IEALARHYSSHPAVIGWQTDNEFSMLDCHCDSCNLAFRSWVQEKYGTTEQVNEEWGTVVW
SGEYSSWDELTVPYGGSPFQNPSMLLDFQRFQWEAAIAFQKTQTEVLRAICPQHFITHNF
HSYPQRLDMHGLAEDLDVASFDYYPNPSPQKQATAPYSGALSLDLTRGIKRRNFWIMEQL
SGPPGCWFPMWRTPYPGLIRAYSWQAIARGADTVVHFRWRSAAAGAEQFWHGLIDHSNVP
GRRFAEFAQLCSEVNGLAPLLEGTGVISQAAILYSHEQMAALRIQPQADGLDYYENIKQY
HRALTRLGIGCDVIGWRQPLEGYKLVIAPSLYLHDEAAAQLLEDFAAGGGTVILTSRSGV
KNMNNICVMQPLPGLFSRAAGVTVEEYDPVGGDVHSLRSPDGILYECSQWCDILRPEGAE
PVAWYADDFFAGAPAVTVNSFGAGRVYYIGTHAEESYWLKLLGDIAPDAGLTLFPELPDG
VQAFTRTGPKGELLFLLNLSRTSQTVGLDKQYRSALTGTPISGPVELAAYGVEILETQG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcggtgtggactattatcccgagcattgggacgagtcgatgtgggagacggat
atcaagttaatgaaggaaaccggagtcaagatagtccgggtagcggagtttgcctggagc
cggcttgaaccggaggaagggagatttgatttcgcctggctggaccgggcgctggatctg
tttcacaaatacgggattcagattgtcatcgggaccccgactgcgacaccgccgcgctgg
cttactaccgcataccccgatgtattgcctgtgtttgccgatggaggcgtattccatccg
ggtgtgcgcggccaccgctgttataacagcgtatcgctgcgtaagtatggcagccggatt
attgaagcgctggcccggcattacagcagtcatcctgccgtcatcggctggcagacggac
aatgaattcagtatgctggactgccactgtgacagctgtaatctggctttccgcagctgg
gtccaggagaagtatggcaccactgaacaagtgaatgaagagtggggaactgtagtctgg
agcggggagtacagcagctgggatgaattgacggttccttatggcggctcgccattccag
aacccttcgatgctgctggatttccagcggttccagtgggaggcggcgattgccttccag
aagacgcagacggaggtgctgcgcgcgatctgcccgcagcacttcatcacccataacttc
cacagctatccgcagcggctggatatgcacgggctggccgaggaccttgatgtcgcgtcc
ttcgattattatccgaacccctcgccgcagaagcaggcgaccgcgccttacagcggggcg
ttatccctggatctgacccgcggcatcaaacgccgcaatttctggatcatggagcagctc
agcggtccgccgggctgctggttcccgatgtggaggacaccttatccggggctcatccgc
gcctatagctggcaggcgattgccagaggtgcggataccgtggtgcatttccgctggaga
agcgcggctgccggtgcggagcagttctggcacgggctgattgaccacagcaatgtgccc
gggcggagatttgccgaattcgcgcagctgtgcagcgaggtgaacggtctggctccgctg
ctggaggggaccggggttattagccaggcggccattctgtattcgcatgagcagatggca
gcactgcggatccagccccaggcggacggactggactattatgagaacatcaagcagtac
caccgggcgctgacccggcttggcatcggctgtgatgtcatcggctggcggcagccgctg
gagggatacaagctggtgattgccccaagcctgtatctgcatgatgaagcagccgcgcaa
ttgctggaggactttgcagcagggggaggtactgtaatccttaccagccgcagcggtgtg
aagaatatgaataacatctgtgtgatgcagccgctgccgggactcttctcccgggcggca
ggcgtaacggtggaggaatatgatccggtcggaggcgatgtccactcgcttcggagccct
gacggaattctgtatgaatgcagccagtggtgcgacattctgcggccggagggagccgag
ccggtcgcctggtatgcagatgatttctttgccggtgctcctgcggttacggtgaacagc
ttcggggcgggcagggtttattatatcggtacccatgcggaggagagttactggttgaag
cttctgggagatattgcaccggatgcgggactaacgctgttcccggaattgccggacggc
gtgcaggccttcacacgcacaggaccaaagggagagctgctgttcctgctgaatctcagc
cggacgtctcagaccgtagggttagacaagcagtaccgcagcgctcttaccggtaccccg
atatctggtccggtagagcttgcggcatatggtgtagagattctggagactcaaggctga

DBGET integrated database retrieval system