KEGG   Paenibacillus borealis: PBOR_19115Help
Entry
PBOR_19115        CDS       T03324                                 

Definition
(GenBank) peptidase M4
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
pbd  Paenibacillus borealis
Brite
Enzymes [BR:pbd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PBOR_19115
Peptidases [BR:pbd01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PBOR_19115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AIQ58810
UniProt: A0A089LFE0
LinkDB All DBs
Position
complement(4370949..4372553)
Genome map
AA seq 534 aa AA seqDB search
MKKTVASLLAGIVALGSFASVGTAAENNERNNPVELFSGSSPISITGQSWKAPAGSASED
KVWGYLESVKGNLHLSAKEDIRGKFKITEQKTNDKTGSQHYRLSQYISGIPVYGADQTLH
IDNAGNVTSLLGSVVEDVYQTIPQPLIQLQTISGADAILAAEQDATLEHGPLGEPQVTPA
ADLYYFIVDGEPKLAYKTEVNVLEPEPLRIRYFISAENGSVLFKYNILENLTGTGTGVFG
DTKTFETRLSGSTYQLYDSTRGKGIVTYTAKNKTSLPGTLLTSTNNVWTDKAAVDAHTYA
ERTYDYYLQHFGRNSLDNNGLQIRSTVHYYTSYNNAFWNGAQIVFGDGDGSTFTLLSGDL
DVVGHELTHGVTEKTSNLEYYGEPGALNESFSDIIGNSIEGANWLIGDKVYTPGVAGDAL
RSLANPPLYGQPDKYSDRYTGTSDEGGVHTNSGINNKAFYLAAQGGTFNGVTVTGIGRED
AVQIYYNALVYYLTTSSNFSAARTAIIQSATELFGAGSAQVTAVTKAYNAVGVY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactgtagcttcacttcttgcaggtattgtagcacttgggtcctttgcctcg
gtgggcactgccgctgaaaacaatgagcgcaataatcctgtcgagctcttctcaggctcg
tcccctatttcgattacgggccaatcctggaaagcccctgcaggctccgcttctgaggac
aaagtatggggatatctcgaaagtgtaaaagggaacctgcatctgtcggctaaagaggat
atccggggaaaattcaaaattacagagcaaaaaacaaacgacaagaccggcagccagcat
taccggttaagccagtatatctcggggataccggtatatggagccgatcaaacgctgcat
atcgacaatgccggcaacgttacctccctgctgggaagtgtagttgaagatgtctaccag
acgatcccgcagccgctaattcagctccagaccatttccggagccgatgccattctggca
gccgagcaggatgccacgctggaacatggaccgcttggtgagccccaagttactcctgca
gcggatttgtattattttatcgttgacggagaaccaaaattagcttataaaacggaagtg
aacgttctggaacccgagcctttgcggatacggtacttcatttctgcggagaatggcagc
gtactgttcaaatataatatcttagagaacctgacgggtacgggcactggagtatttgga
gataccaaaacattcgagacacgtctctcgggttcaacgtaccagctctatgacagtacc
cgcggcaagggcattgtgacctataccgccaagaacaagacctctcttccggggacgctc
ttaaccagcaccaacaatgtctggacagacaaagccgcggttgatgcccacacgtatgct
gagagaacctatgattactatctccagcatttcggccgcaacagcctggacaacaacgga
ctgcagatccgttccaccgtccattactatacttcctataacaacgcattttggaatggc
gcgcaaattgttttcggtgatggagatggatctacctttacactgctgtccggggatttg
gatgtggtaggccacgagctgacgcatggtgtgactgagaaaacatccaatcttgaatac
tacggagaaccaggggcactcaatgagtccttctccgacatcatcggaaattcaattgaa
ggtgcgaactggctgatcggcgataaagtatatacaccgggtgtagcgggtgacgcactc
cgctcactggctaatccgccattgtacggccagcctgacaagtacagcgaccgttatacc
ggtaccagtgacgaaggcggtgtgcatacgaacagcggcatcaataacaaagctttctat
ctggctgctcaaggcggtacgtttaacggtgtaacggtcacaggtatcggccgtgaggat
gccgttcaaatctattacaatgcacttgtatattaccttacaacctcatccaacttctct
gctgcacgcacagcaatcattcaatcggctactgaattgtttggagcaggctcggctcaa
gtaactgccgtaaccaaagcttataatgcggtaggcgtctactaa

DBGET integrated database retrieval system