KEGG   Polyangium brachysporum: AAW51_4255Help
Entry
AAW51_4255        CDS       T04216                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
pbh  Polyangium brachysporum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5028879..5034095
Genome map
AA seq 1738 aa AA seqDB search
MTQPVDSLPNFYSVIRHWAAQAPQRLAFNFLADGDTTEATLTYGELDRRARAVASVLQAR
GWADAPVLLQYRPGLDFIVAFFGCLYAGSIAVPAYPPTGNRSKSDRLQKLVASCGAVVVL
TNNTTRGDLERDLDGAAATLPVVCTDALGDAGADDWRDPQADRQRIAFLQYSSGSTGDPK
GVVVTHGNLMHNQATIRAAMGNGDHTVFASWLPLFHDMGLIGNVMQPLYLGVPCHLMPPM
AFLQKPLRWLKLISEQRVTCTGGPNFAYDLCVDKISDTERASLDLSSWQVAYNGSEPVRA
ETLRRFADAYAPHGLAAGALYPCYGLAEGTLFVTGPEPGAGARVLDLDARALESGLVRPA
HGDARSSRALTSCGRVWGGQSVLVVDAATRTRCADGQVGEIWLQGESITGGYWQRPDANA
QSFATLADAADAGRYCRTGDLGFFSNGELYVTGRLKEMMIVRGRNHYPQDIEHTVQQAWP
GFVRGGGAAFVDGEPGRERLVLVQEIARTALRGYQHAQAEELAREAVALHHGLTLSELVP
IKPATLAKTSSGKIRRDFMRTAWRQGELTRVDLGLPAGRGESGPAAATLPPHYATLRDAL
IELDVPATAIDARHTLLQLGLDSLQLVELQSRLARRLGAAPAIETLFRAQSLAALAAELD
RVQPVTPSADTQLRTPEVETDTLTPYQWAIWLKQQQTEAPIYNLAVAFEFEPHLDTGRIA
AAHAQLLERHRHLRSHVVEGPAGELRWQPLDTPAAARLCALQCERVDGWSETQVDAALAA
FRRRPFRLEQEPPLRAWLLERAGRGPLLALCMHHITTDFHGAGALVDELLRSVATPGDVL
APPAPAPHALLAEVATSAPAADEGWLDTLAAADADLDLGLPAPAAPGLLPLASVDRALPG
DLVKALRDTARDTGSTLNVLLAAAFAALLHRYTGQDSLCLGMPFSVRPDTLLDWPGNAVN
MVPLALRFSDADTLQTLTDQTTHAVAAGLRHRHLPLMQVAEGVRRRQPGRTQLFDAVFIC
QPERGGARQAAAALLAGSEAWRSSGQWPGLRVRSRQVTASAGQALLTLLVFPHADGARLA
LEYDPQRLPADFASRVLDHYAGLLRTFVRDPRQPIARADYLSADELALQWQAWNAAGHAT
PDTVRRTTLVELFQQQVAARPDAVAVLDASGSALRYAELATQARQWCAQLQRLGVGRGDC
VGVALPRDRHLPAALLGVLMSGAAYVPLDLDYPAARLHHILDSSGARCVVTVPAQAQRFT
ASGRPCLFHDSTAASAEVRPVPLSPADPAYVLYTSGSTGQPKGVQVTHGNVVALLAWAYQ
ALDESERARVLASTSVCFDLSVFEFFVPLCGGTTCVVVERILDLIESVPAPVTLINTVPS
AIDALVAARAVPDSVLTALVAGEPFRQALVERLYAGSRVRRVLDLYGPTEDTVYSTCAER
RPGGRETIGRPLPGTRAYLLDARQQPVPAGLPGELYLAGSGLSLGYRGRDDLTAEAFALP
AALAHLEQRVYRTGDIVRYTAGGEIVYLGRRDHQVKVRGYRIELQEVEACLLRGDAVQEA
VAHVVPSGQGHATLVAYVVWQGAGDDTVRQRELNAHLARQLPSYMRPSVIVTLAQLPRTL
NGKVDRKALPTVQLADSRDATPLQPGLETELAALWGAVLGTTPTQRRDHFIELGGNSLSA
VQLRTALKREWALDVPLAALIAVPVLADQAELLREMSARPAAADDTSGAATELEEVEL
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccggtcgactccctgcccaacttctattcggtgatccgccactgggcggcg
caagcgccccagcggctggccttcaacttcctggcagacggcgacaccaccgaggccacg
ctcacctacggcgaactcgaccgccgggcgcgagcggtcgccagcgtgttgcaggcccgt
ggctgggccgacgcaccggtgctgttgcaataccggccgggcctggacttcatcgtcgcg
ttctttggttgcttgtacgccggcagcatcgcggtgccggcctatccgcccaccggcaac
cgttccaaatccgaccgtttgcaaaagctggtcgccagctgcggcgccgtcgtcgtgttg
accaacaacaccacgcgcggtgacctcgaacgcgacctcgacggggcggccgccacactg
ccggtggtctgcaccgacgcgctcggcgacgcaggcgccgacgactggcgcgaccctcag
gccgacaggcaacgcatcgccttcctgcagtactcgtccggctccaccggcgacccgaaa
ggtgtcgtcgtgacgcacggcaacctgatgcacaaccaggccaccatccgcgcggcgatg
ggcaacggcgaccacaccgtgttcgccagctggctgccgctgttccacgacatgggcctg
atcggcaacgtcatgcagccgctgtatctgggcgtgccttgccatttgatgccgccgatg
gccttcctgcagaagccgctgcgctggctgaagctgatttcggagcaacgtgtcacttgc
accggcggccccaacttcgcctacgacttgtgcgtggacaagatcagcgacaccgagcgc
gcctcgctcgacctgtcgagctggcaggtggcgtacaacggctccgagccggtgcgcgcc
gagacgctgcgtcgttttgccgacgcctatgcgccgcacggccttgcggccggcgcgctc
tacccctgctacgggctggccgagggcacgctgttcgtcaccggccccgaacccggggcc
ggtgcgcgggtgctcgacctcgacgcccgcgcgctcgaatccggcctggtgcggccggcg
cacggtgatgctcggtcgtcccgggcgctgacaagttgcgggcgggtctggggtggtcag
tcggtgctggtcgtcgatgccgccacgcgcacccgttgtgccgacggccaggtcggcgaa
atctggctgcagggcgagagcatcaccggcggctactggcagcgcccggacgccaatgcc
caaagcttcgcgacgcttgccgatgcggccgacgcgggccgctactgccgcaccggcgat
ctcggcttcttctcgaacggcgagctgtatgtgaccggccgcctgaaggagatgatgatc
gtgcgcggacgcaaccactacccgcaagacatcgagcacaccgtgcagcaggcctggccg
ggcttcgtgcgcggcggcggcgccgccttcgtcgacggtgagccgggccgcgagcggctg
gtgttggtgcaggagatcgctcgcaccgcattgcgcgggtatcagcacgcgcaggccgag
gagttggcgcgcgaggcggtcgcgctgcaccacgggttgacactgtcggagttggtgccg
atcaaacccgcgacgctggccaagacctcgagcggcaagatccgccgcgacttcatgcga
acggcgtggcggcagggcgagctgacgcgggtggacctggggctgccggccgggcgcggc
gagagcggccccgcggcggcgacgctgccgccccactacgccacgttgcgcgacgcgctg
atcgagctcgacgtgccggccacggccatcgacgcccgacacaccctgctgcagctcggg
ctcgactcgctgcagctggtcgagctgcagtcgcgactggcccggcgcctcggggccgcg
cccgccatcgaaacgctctttcgcgcccagtcgctcgcggcactggccgccgagctggac
cgcgtgcagccggtgacaccgagcgccgacacccagctgaggacgcccgaggtcgagacc
gacaccctgacgccgtatcaatgggccatctggctgaagcagcagcaaacggaggcgccg
atctacaacctggcggtcgccttcgagttcgagccgcacctcgacaccggccgaattgcg
gctgcgcatgcgcaactgctcgaacgccatcgccacttgcgcagccacgtcgtcgaaggc
cccgccggcgaactgcgctggcagccgctcgacacacccgccgccgcccgcctctgcgcg
ctgcaatgcgagcgcgtcgacggctggagcgagacgcaggtggacgccgcactggcggcc
ttccgccgccgccccttccgcctcgagcaggagccgcccttgcgcgcctggctgctcgaa
cgcgccggacgcggcccgctgctcgcgctgtgcatgcaccacatcacgaccgacttccac
ggcgccggcgcgctcgtcgacgagttgctgcggtcggtggcgacccccggtgacgtgctg
gcgccgcccgcgcccgcaccgcacgctttgctggctgaggtggcgacgtccgcccccgcg
gctgacgagggctggctggacacattggccgcggccgatgccgatctcgacctcggactg
cccgcccccgccgccccgggcctgctgccgctggccagtgtcgaccgcgcgctgccgggc
gatctcgtcaaggcgctgcgcgacaccgcccgcgacaccggcagcaccctcaacgtgctg
ctcgccgccgcctttgcggcgctgctgcatcgctacaccgggcaggactcgctgtgcctg
ggcatgccgttctcggtgcggccggacacactgctcgactggcccggcaatgccgtcaac
atggtgccgctggcgctgcgcttctcggacgccgacacactgcagacgctgaccgaccag
accacgcacgcggtcgccgccgggctgcgccaccgacacctgccgttgatgcaggtcgcc
gaaggtgtgcggcgccggcagccgggccgcacgcagttgttcgacgccgtgttcatctgc
cagcccgagcgcggtggcgcccggcaggcggcggcggcgctgctggccggcagtgaggca
tggcgcagcagcgggcaatggcccgggctgcgggtgcgctcgcgtcaggtgacggcgagc
gccggccaggcgctgctgacgctgctggtgttcccgcacgccgatggcgcccgcctcgca
ctcgaatacgacccgcaacgcctgccggccgacttcgcctcccgtgtgctggatcactac
gccggcttgctgcggaccttcgtgcgcgacccgcggcagcccattgcgcgagccgactat
ttgtccgcggacgagttggccttgcaatggcaggcgtggaacgcggccggacacgcgaca
ccagacaccgtacggcgcaccacactggtcgagctgttccagcagcaagtcgcagcccgg
cccgacgcggtggcggtgctcgatgcgagcggcagcgccttgcgctatgccgagctggcg
acgcaggcgcggcagtggtgtgcacagctgcagcgcctgggcgtcggccgtggcgactgt
gtcggcgtggccctgccccgcgaccgtcacctgccggccgcgctgctcggggtcctgatg
agcggtgccgcctatgtaccgctcgacctcgactacccggcggcccgtttgcatcacatc
ctcgacagcagcggcgcgcgttgtgtggtcacggtgccggcgcaggcgcagcggttcacc
gccagtggccgcccctgcctgttccacgacagcacggccgccagcgccgaagtgcggccc
gtcccgctcagtccggcggaccccgcctatgtgctctacacctccggctcgaccggccag
cccaagggcgtgcaggtgacacacggcaacgtggtggcgctgctcgcctgggcgtaccag
gccctcgacgagtcggagcgcgcccgggtgctcgcctccacctcggtgtgtttcgacctg
tccgtgttcgaatttttcgtgccgctgtgtggcggcaccacctgcgtggtggtcgagcgc
atcctcgacctgatcgaatcggtgccggcgccagtgaccctgatcaacaccgtgccctcg
gcgatcgacgcgctggtggccgcgcgtgccgtgcccgacagcgtgctgaccgccctggtc
gcgggcgaaccgttccgccaggcgctggtcgagcggctctacgccggcagccgggtgcgt
cgggtgctcgacctctacgggccgaccgaagacaccgtgtattccacctgcgccgagcgc
cgccccggcgggcgcgagaccatcgggcggccgctgcccggcacccgtgcctacttgctc
gacgcccgtcagcaaccagtgccggcgggcctgcccggcgagctgtacctggccggcagc
ggcctgagcctcggctaccggggtcgcgacgacctgaccgccgaggcattcgccttgccg
gccgcgctcgcccacctcgagcagcgcgtctaccgcaccggcgatatcgtgcgctacacg
gccggcggcgagatcgtctacctggggcgacgtgaccaccaggtcaaggtgcgtggctac
cgcatcgagctgcaggaggtcgaagcctgcttgctgcgaggtgatgcggtccaggaggcg
gtggcccatgtcgtgccgtcggggcaagggcatgcgacgttggtggcctatgtggtgtgg
caaggcgcgggcgacgacaccgtgcggcaacgcgaactgaacgctcacctggcgcgccag
ctgccgagctacatgcggccgtcggtgatcgtgaccttggcgcagctgccccgcacgctc
aacggcaaggtcgatcgcaaagccttgcctacggtccagctggccgacagccgcgacgcc
accccgctccagcccggcctggaaaccgagctcgccgccttgtggggcgccgtgctcggc
accacgccgacgcagcgtcgcgatcacttcatcgagctgggcggcaactccttgtcggcc
gtccaactgcgcaccgcactgaagcgcgagtgggcgctggatgtgccgctggcggccctg
atcgccgtgcccgtgctcgccgatcaggccgagctgctgcgcgaaatgtcggcccgcccg
gccgctgccgacgacacgtctggcgccgccaccgaactcgaggaagtcgaactgtga

DBGET integrated database retrieval system