KEGG   Python bivittatus (Burmese python): 103051995Help
Entry
103051995         CDS       T03091                                 

Gene name
KLKB1
Definition
(RefSeq) kallikrein B1
  KO
K01324  
plasma kallikrein [EC:3.4.21.34]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     103051995 (KLKB1)
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103051995 (KLKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 608 aa AA seqDB search
MSKIYRNTYIQGGDISKVYTPTADYCQMVCTYHPRCLLFSYIPGNWAKNTARFSCFLKEI
DTQELPKVPQEGIISGHSLKQCTQITACSKKVYEGLDMQGENYNITTADNYHRCQQRCTN
DKHCYFFTYTLESFHSPALRNKCYLKYSSTGTPTQIRQLRDVVSGFSLKPCQLAQTDCQM
DFFQHFAFSGITVAKVLTPDKFVCRTVCTYRPNCLFFTFFSSEWEIKSQRYTCLMMTSRS
ETPDRIAERANAISGFSLLNCQRAEPACHSQTYPELNFHGTELSVEYVDGHKACQELCTM
TLRCQFFIYVFRKMQCNHEGKCKCYLRMSANGSPDNIEAKNEIVSGYSLRLCQTSRSPVC
VQKPKQQSRIVGGSNSSVGEWPWQVSLHTKLSIQSHHCGGSIISDQWILTAAHCLEDIPL
TEHWHVYSNILKQSEITNETTFFKVQKMIIHPRYEISEAGYDIALLKLDTPMNFSVLQQP
VCLPSQEEMNMAKYTECWVTGWGYTKERGTIEDTLQKVKIPIMPNAECQFQYPEHRITDK
MLCAGYPEGGKDACQGDSGGPMSCKFQNSWYLVGITSWGEGCARPGQPGVYTNVAKFVDW
ILEQTLED
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatctacagaaacacatatatccaaggaggagacatatctaaggtttatact
ccaactgcagactattgtcagatggtgtgcacttatcacccaagatgtcttttgttctcc
tacatacctggaaactgggcgaaaaatactgcaaggttttcttgcttcctgaaagaaatt
gatactcaagaattgccaaaagtaccccaggaaggaataatctctggtcattctctgaag
caatgcactcaaattactgcttgcagcaaaaaagtatacgaaggactggatatgcaagga
gaaaattacaatataactactgctgacaattatcatcgctgccaacagagatgcaccaac
gataagcactgttactttttcacgtataccttagaatcatttcacagcccagctctgcgt
aataaatgctacttgaaatatagtagcacaggaaccccgacccagataaggcagcttagg
gatgttgtctctggattctcattgaaaccatgccaacttgcccaaacagattgtcagatg
gactttttccaacattttgcattttctggaattactgttgcaaaggttttgacccctgac
aaatttgtatgtagaacagtttgtacttaccgtccaaactgcttattctttacatttttc
agcagtgaatgggagataaaaagccaaaggtatacctgtctgatgatgacttcaagaagt
gaaacaccagacagaattgcagaaagagcaaatgctatatcaggattcagtctcctgaac
tgccaaagagctgaacctgcatgccattcccagacctaccctgaattaaacttccatggg
acagaactgagtgtagagtatgtcgatgggcacaaggcttgtcaagaactttgtacaatg
accctccgctgccaatttttcatttacgttttccgtaaaatgcaatgcaaccatgaaggc
aaatgtaaatgctacttaagaatgtctgccaatgggtctccagataatatcgaggccaag
aatgaaatagtttcaggctactctttaaggctgtgccaaactagcagaagccctgtctgt
gtgcagaaaccaaagcaacagtcaaggattgttggaggctcaaattcttctgttggcgaa
tggccttggcaagtcagtttacatacaaagctctctattcagagccatcattgtggtggt
tcaatcatcagtgaccaatggattttgacggctgcccattgcttagaagacattccgtta
actgaacattggcatgtttacagcaacattttgaaacagtctgaaataactaatgaaact
accttcttcaaagtccaaaagatgattattcatcctaggtatgagatttcagaggcagga
tatgacattgctttactaaagcttgatacacctatgaatttcagtgttttacagcaacct
gtatgcctgccctcccaggaagaaatgaacatggcaaaatacactgagtgctgggtgacc
ggatggggttacacaaaagagagaggcacaatcgaagacacgctacaaaaagtcaaaatc
cccataatgccaaatgcagaatgtcagtttcaataccctgagcacagaataactgacaag
atgttgtgcgccggttacccagaagggggcaaggatgcttgccagggagattcaggcggc
ccaatgtcgtgtaaattccagaacagttggtatttggttggcattaccagctggggtgaa
ggatgtgctcgtccaggacaaccaggagtttacaccaatgtggctaagtttgtagactgg
attctggaacaaacgttagaagattaa

DBGET integrated database retrieval system