KEGG   Python bivittatus (Burmese python): 103053131Help
Entry
103053131         CDS       T03091                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103053131 (SETDB1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103053131 (SETDB1)
Chromosome [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103053131 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103053131 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1261 aa AA seqDB search
MAESPEIIELQREVMEELGISLEDLKQLIEEELEKSECIKQRKEELERLEECVKKKEAEV
AHVDQLLENAVKAVDKCEVLVKDVYANLGLEYRETDSDDDNGSCKPMEVIEIPDEDDDDI
MSVDSADPSNKIAKDQTLLREAMAAMRKSAQDVQKFMDAVNKKSGSLDAQRGLQQVSPSC
ELTHDGDLTVGDRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYD
HHPPADRLHVGSRVVAKYKDGNQVWLYAGIVAEMPNVKNKMRFLIFFDDGYASYVIQPEL
YLICRPLKKSWEDIEDVSCRDFIEEYVTAYPNRPMVLLKSGQQIKTEWEGTWWKSRVEEV
DGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTHDKKQGGQMRTRPNVGAVRTKG
PVVQYIHDLTGTSPQQLKPAEPQVPVSTPQPVSPLFGETDSESQLAQAKKQQVAKKSTSF
LRPGSAGSGLSPPSSPVLSETPPVGRTGVTQQFRFSGTQPGAGSVPPFHGMMDRVPSEPS
YRAPVEKLFYLPHVCSMKCLSRVCPSHRDQHRSRNPLLIPLLYDFRRMTARRRINRKTGF
HVIYKTPCGLCLRSMSEIERYLFETDCDFLFLEMFCLDPYVLVDRRFQPYKPFYYIADIT
KGKEDVPLSCVNEIDSTPPPQVAYSKERIPGKGVYINTSWEFLVGCDCEDGCRDKSKCAC
HQLTIQATACTPGGQINLNSGYQHKRLEECLPTGVYECNKRCKCSPNMCTNRLVQHGLQV
RLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESV
ENSKEGYESEAKCSSDSSGVNLKDDDDDNSGSEEAEESNEDSSDDNFCKDEDFSTSSVWR
SYATRRQTRGQRENGLSETASKDSGLARQVSHEEAPPCKPPLSEETSKNKVASWLSSNTM
SDSYHDSDSRSSFRMQEAAEAKPPKGEPGEGEKARTPGLAGKDELSLEGELKLKKKEESD
DPGKATPGHPSRVYGYNPNPSIPEGVRRPPSKTASHQIRRPSKIQQGLPDDVLMLSSSTE
SEGDTGRATSGHAQGNANDSDDIQTISSGSEEEPAADEKNASSGLGPVKRQVAVKSTRGF
ALKSTHGIAIKSTNLASGENAALRRNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNL
FVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKKLLCCCGAIECRGRL
L
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtccccggagataatagaactccagcgagaggtcatggaagaactgggcatc
tctctggaagacctcaagcagttaattgaagaagagttggagaaatcagagtgcatcaag
caacggaaggaggagctggagcgcttggaggagtgcgtgaagaagaaagaggccgaggtg
gcccatgtagaccaactccttgaaaatgcggtgaaggcggtggataaatgcgaagtgttg
gtcaaagacgtctatgccaacttggggctggaatatcgagagacggactcagatgatgat
aacggctcttgcaaaccgatggaagtgattgaaataccagatgaagatgatgatgacatt
atgagcgtagattcagcagatccaagtaacaaaattgcaaaagaccagacactgcttcga
gaagccatggccgccatgcggaagtctgcccaagacgttcagaagttcatggatgcggtt
aataagaagtcgggcagcctggacgctcagagaggattgcagcaggtcagccctagctgt
gaactcacccacgatggtgacctcacagtcggcgaccgcatcctgggcaagaagcggacg
aagacctggcacaagggcaccttgatcgccatccagacagtgggtcctgggaagaaatac
aaggtgaagtttgacaataaagggaagagtttgctgtcgggcaaccacattgcttacgac
caccacccaccggcggacaggctgcacgttgggagccgtgttgtggccaagtacaaagac
ggcaaccaagtgtggctgtatgcaggaatcgtcgccgagatgcccaacgtcaagaataag
atgaggttcctgatcttctttgatgatggttacgcctcctacgtaattcagccggagctg
tacttgatctgcagacctctcaagaaatcctgggaggacattgaagacgtctcctgccgg
gattttatcgaggaatacgtcaccgcgtatccaaaccggcccatggtcttgctcaagagc
ggccagcagatcaagacggagtgggaggggacgtggtggaagtcccgggtcgaggaagtg
gacggaagcctggtcaaaatcctcttcctggacgataaacgttgcgagtggatctaccgg
ggctccacccgcctggagcccatgttcagcatgaagacgtccaccgcctccactcacgac
aagaaacagggcgggcagatgaggacacgccccaacgtgggggccgtgcggaccaagggc
ccagtggtgcagtacatccacgacctcacgggaaccagtcctcagcagctgaagcctgca
gaacctcaggttcccgtctcgacgccccagccagtctcacccctgtttggggaaacagac
tccgagagccagctggctcaggccaaaaaacagcaggtggcaaaaaaaagcacctcgttc
ttgcgccccggctcggcaggatcaggcctgtcgcccccgtcctcccccgtcctgagcgag
acgcctcccgtgggccggacaggagtaacccagcagttcaggttctccggcacccagccc
ggggcaggctctgtcccgcccttccacggtatgatggaccgggtccccagcgagccgtcc
taccgggcccctgtggagaagctcttctacctgccccacgtctgcagcatgaagtgcctg
agccgggtgtgccccagccacagggaccagcaccgcagccggaaccccctcctgatcccc
ttgctctatgacttccggcgcatgacggcccgccggcggatcaaccgcaagacaggcttc
cacgtcatctacaagacgccgtgcgggctgtgcctgcgcagcatgagcgagatcgagcgc
tacctcttcgagacggactgcgacttcctcttcctggagatgttctgcctcgacccctac
gtcctggtggaccgccggttccagccctacaagcccttctactacatcgccgacatcacc
aaagggaaggaggacgtccccttgtcctgcgtcaacgagatagatagcaccccgccgccc
caggtggcttacagcaaggagcgcattccgggcaaaggggtctacatcaacaccagctgg
gagttcctggtgggctgcgactgcgaggacggctgcagagacaaatcaaaatgtgcctgc
caccagctgacaatccaggccaccgcgtgtacccccggtggacagatcaacctcaattct
gggtaccaacataagcgcttggaggaatgtcttcccacaggagtgtacgagtgcaacaag
cgttgcaagtgcagcccgaacatgtgcaccaaccgcctggttcagcacggtctgcaggtc
cggctgcagctgttcaagacacagaacaaaggctggggcatccgctgcttggatgacatc
gccaagggctccttcgtctgcatctacgcagggaaaatcctgacggatgattttgccgac
aaagagggcttggagatgggcgacgagtatttcgccaacctggaccacatcgagagcgtg
gagaactcgaaggagggctacgagagcgaggccaagtgctcctcggacagcagcggcgtc
aacctgaaggacgacgacgacgacaactctggctcggaggaggcggaggagtccaacgag
gacagctcggacgacaacttctgcaaggacgaggacttcagcaccagctcggtctggcgc
agctacgccacccgccggcagacgcggggccagcgggagaacggcctctccgagacggcc
tcgaaggactcaggcctggcccggcaggtcagccacgaggaggccccgccgtgcaagccg
cccctctccgaggagacctccaagaacaaggtggcctcctggctcagctccaacaccatg
tccgacagctaccacgacagcgacagccggtcctccttccggatgcaggaggcggccgag
gccaagccccccaagggggagcccggcgagggcgagaaggccaggacccccgggctggcc
ggcaaggacgagctgagcctggaaggggagctgaagctgaagaagaaagaggaatcggac
gatccaggcaaagcaacgccgggccacccaagcagggtgtacggctacaaccccaaccca
tccatccccgagggggtccgacggccgcccagcaagaccgcctcccatcaaatccgaagg
ccgtccaagatccagcagggactccccgacgacgtgctgatgctctccagcagcaccgag
agcgagggagacaccgggcgggcgacttctgggcacgcccagggcaatgccaacgacagc
gacgacattcagaccatatcttccgggtcggaggaggaaccggccgcagatgagaagaac
gcctcttctgggctgggaccggtgaagaggcaggtggcggtgaagtctacccggggcttc
gccttgaagtccacgcacggcatcgccatcaagtcgaccaacctggcttccggggaaaac
gcggccctccggaggaacacgcgccagttctacgacggggaggagtcgtgctacatcatc
gacgccaagctggagggcaacctggggcggtacctcaaccatagctgcagccccaacctc
ttcgtccagaacgtcttcgtggacacgcacgacctgcgttttccctgggtggccttcttc
gcaagcaagcgaatccgggccgggacagagctcacctgggattacaactacgaagtcgga
agcgtcgagggcaagaaattgctgtgctgttgtggcgccattgaatgccgaggccgcttg
ttgtaa

DBGET integrated database retrieval system