KEGG   Python bivittatus (Burmese python): 103058754Help
Entry
103058754         CDS       T03091                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    103058754 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103058754 (HDAC2)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103058754 (HDAC2)
Chromosome [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103058754 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     103058754 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103058754 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    103058754 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARLEEDKKEAEDKKADIKEEDKSKDNSSEKVDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatagtcaaggaggcggcaagaagaaagtctgttactactatgacggtgatatt
ggaaactattattatggccagggacatccaatgaagcctcacagaatccgtatgacacac
aatttattgctaaattatggcttgtacagaaaaatggaaatctatcgcccccacaaagct
acagcagaagaaatgactaaataccacagcgatgaatacatcaaatttcttcgttcaata
agacctgacaatatgtctgaatatagcaaacaaatgcagagatttaatgttggggaagac
tgtcctgtctttgatggactgtttgagttctgtcagctgtcaacaggaggctctgtagct
ggagcagtaaaattgaatagacaacaaacggatatggctgttaattgggcgggaggactt
catcatgctaagaaatcagaggcatctggtttctgttatgttaatgatattgtgcttgct
attcttgagttattgaaataccatcaaagagttctttacattgatattgatatccatcat
ggtgatggtgttgaagaagctttttataccacagatcgagttatgacagtatcattccat
aaatatggtgaatatttccctggaacaggagatttaagggacataggagctggaaaaggc
aaatattatgcagttaactttccaatgagagatggaatagatgatgagtcatatggacaa
atatttaaaccaattatatccaaagtgatggaaatgtaccaacctagtgctgtggtattg
cagtgtggggcagattcactctctggtgatagactgggatgttttaatcttactgttaaa
ggtcatgccaaatgtgtggaagttgtgaagactttcaatttgcctcttttgatgcttgga
ggaggtggatacaccatacgcaatgttgctcgctgttggacctatgagactgctgttgcc
ttagactgcgaaattcctaatgaattgccatataatgattattttgagtactttggacca
gatttcaaactgcatattagcccatcaaatatgacaaatcagaacactccagaatatatg
gaaaagattaagcagcgtttatttgagaatttgcgcatgctgccccatgctcctggtgta
cagatgcaagctattccagaagatgctgttcatgaagacagtggtgatgaagacggtgaa
gatccagacaaacgtatttctattcgtgcttctgataagaggatagcctgcgatgaggaa
ttttctgattctgaagatgaaggagaaggtggacgcagaaacgttgcagatcataagaaa
ggagcaaagaaggcgcgcttagaagaagacaaaaaagaggcagaagacaagaaagcagat
attaaagaagaagataaatctaaagataatagtagtgagaaagtagataccaaaggcaca
aagtcagaacagctaagcaatccttga

DBGET integrated database retrieval system