KEGG   Python bivittatus (Burmese python): 103061045Help
Entry
103061045         CDS       T03091                                 

Definition
(RefSeq) trypsin I-P38-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103061045
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103061045
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103061045
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103061045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKFIWLVAFLGTAVAFPIDEDDDDKIVGGYTCKKHSVPYQVSLNSGYHFCGGSIINSQWI
VSAAHCYKSRVQVRLGEHSLAQNDGSEQYINSVKVIRHPSYNSQTLNNDIMLIKLSKPAS
LNSRVSAVRLPSSCPSTGTTCLISGWGNTVSSGTNNPDLLQCLNAPVLSQSQCSKAYPGK
ITNNMLCIGYMEGGKDSCQGDSGGPVVCNAVLQGIVSWGIGCAQKGYPGVYTKVCNYVSW
IQSTIRSN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatctggttggtagcattcttgggaacagctgttgctttccccatcgatgaa
gatgatgatgataagattgtgggcggctacacctgcaaaaagcattcagtcccctatcag
gtctccctgaattctgggtaccatttctgtggtggctccatcataaacagccaatggatt
gtatcagctgctcactgctacaagtcccgagtccaagtgagacttggggaacacagtttg
gctcaaaatgatggctctgagcagtacattaattcagtcaaagtcattcgtcatcccagc
tacaactcccaaactttgaacaatgacattatgctcatcaaactgtccaaaccagccagt
ctcaattcccgtgtttcagcagtccgtctaccaagcagctgtccttccactggcacaaca
tgtttaatctctggctggggcaacaccgtcagcagtggcacaaacaatcctgacctcctc
cagtgtctgaatgcccctgtgctttctcagagtcagtgcagtaaggcttatccagggaaa
atcaccaacaatatgctttgtataggatatatggaaggcggaaaagactcttgtcaggga
gactctgggggcccggttgtctgcaatgcggtactccagggaattgtctcttggggcatt
ggatgtgctcagaaaggttaccctggtgtctacactaaagtttgcaactacgtttcctgg
attcagagcaccatcagatccaactga

DBGET integrated database retrieval system