KEGG   Python bivittatus (Burmese python): 103061054Help
Entry
103061054         CDS       T03091                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    103061054 (HDAC4)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103061054 (HDAC4)
Chromosome [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103061054 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 893 aa AA seqDB search
MEIVFLTSVITFFFRKTQHSSLDQSSPPQSGASGTYNHPVLGMYDSKDDFPLRKTASEPN
LKLRSRLKQKVAERRSSPLLRRKDSPVATALKKRPLDVTESACNSAPGSGPSSPNNSSSN
ISTENGVGSVANIHAETNLAHRPVNREGSITQLPLYTSPSLPNISLGLPAAAPCTGGSGQ
QDSERLAIPSLQQRISIFPGTHITPYLSSTAVDREGGSTHSPLLQHMVLLEQSTAQNPLV
SGLGALPLHAQSLVGADRLSPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQQHQQFL
EKHKQQFQQQQLHINKMMPKSNEASRQHESHPEETEEELREHQAFLEDQYIDRVANQKEI
QGLTQMVHVKQEPAESDEDGEQQELEPGQRQAEQELLFRQQTLLLEQQRIHQLRNYQASM
EAAGIPVSFSGHRPLSRAQSSPASANFPLSTQETPCKPQFTTGLVYDTLMLKHQCICGNT
NSHPEHAGRIQSIWSRLQETGLRSKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQK
LDSRKLLGSLTSLFVRLPCGGIGVDNDTIWNEVHSFSAARLAVGCVVELVFKVATGELKN
GFAVVRPPGHHAEESTPMGFCYFNSVAISAKLLQQRLNVNKILIVDWDVHHGNGTQQAFY
SDPNVLYISLHRYDDGNFFPGSGAPDEVGIGLGVGFNVNIAFTGGLNPPMGDPEYLTAFR
TIVMPIAHEFAPDVVLVSSGFDAVEGHPAPLGGYNLSAKCFGYLTKQLMGLAGGRIILAL
EGGHDLTAICDASEACVSALLGNELDPIPEKILQQTANVNAVHSIEKVIEIHSKYWHSLQ
RYSSTVSYSLIDAQKCDNEEAETVTAMASLSVGVKPLPEKNLDEEPMEEDPLL
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtattcttaacctctgtaataacatttttttttaggaaaacacaacatagt
tctcttgatcagagctctccaccacaaagtggagcatcaggcacttacaatcaccctgta
ttaggaatgtatgattccaaagatgattttccactcagaaaaacagcatctgagcccaat
ctcaaattgcgatctagattaaagcagaaggttgctgaaaggcgcagcagtcctttgtta
agacgaaaagatagtcctgtagctacagctcttaaaaaacgtccattagatgtcacagaa
tctgcatgcaatagtgctcctggatctggtcctagttctccaaacaatagttccagtaat
ataagcactgaaaatggagttggatcagttgcaaatattcacgcagagaccaacttggct
catagacctgttaatcgtgaaggctcaataacacagcttccattgtatacatctccctcg
ttgcctaatatatccttaggactacctgcagctgccccatgtactggtggatcaggacag
caagattctgaaagacttgctattccatcattacaacaacgaatctccatatttcctggc
acccacatcactccttatttgagcagtacagcagtggatagagaagggggatcgacacac
agccctcttctccagcacatggttttactggaacagtcaactgcacaaaatccattagtc
tcaggactaggggcactcccgctccatgctcaatctcttgtgggtgctgataggctgtct
ccctcaatacacaaactgcggcagcaccgccctctggggcgcacacagtctgctcctctt
cctcaaaatgcacaggccctccagcaattagtgatccaacaacaacatcagcaattcttg
gaaaaacacaaacagcaatttcagcagcagcagttgcacattaacaagatgatgccaaaa
tcaaatgaggcttcccgtcagcatgaaagccatcctgaagagactgaagaagaattaaga
gaacatcaagcatttttggaagaccaatatattgacagggtagcaaatcagaaggaaatt
caaggattgacccaaatggtccatgtgaagcaagaacctgctgaaagtgacgaagatgga
gaacaacaagaattagaaccaggacaaaggcaagcagagcaggaactgctcttcagacag
caaactcttctactggagcagcaacgtattcatcagctcagaaactatcaggcatccatg
gaagctgctggcattccagtatcctttagtgggcatcggccactttctcgagcccagtca
tcacctgcttctgccaactttccattatctacacaggagacaccatgtaagccacagttc
acaacaggccttgtatatgacaccttgatgctgaaacaccagtgcatctgtggaaacaca
aacagtcacccagaacacgcagggagaatccaaagcatttggtcacggcttcaggagaca
ggtcttcgtagcaagtgtgagtgcatccgtggaagaaaagcaactctagaagaattacag
accgtgcattcagaagcacacacactgctttatggtaccaaccctttgaacagacagaaa
ttggacagcaggaaactgttaggctctctgacatcactgtttgtcagacttccatgtggt
ggcattggggtggacaatgatacaatttggaatgaagtgcattcattcagtgctgctcgt
cttgctgttggctgtgtcgtagagcttgtttttaaagtagctacaggagaactaaagaat
ggatttgctgtagttagacctcctggtcaccatgcagaagaaagtacgcctatgggtttt
tgctattttaactctgtggccatttctgccaagcttctccagcagagattgaatgtgaac
aaaatccttatagtggactgggatgtacatcatggaaatggtacccagcaagctttctac
agtgatcccaatgtcctttatatttcactacatcgctatgatgatggaaacttcttccct
ggcagtggagcccctgatgaggttggcataggattgggtgttggtttcaatgtaaatata
gcgtttactggtggtcttaatccaccaatgggagacccagaatacttgactgctttcaga
acaatagtaatgcctattgctcatgagtttgctccagatgttgtactggtgtcatcaggt
tttgatgcagtagaaggtcatcctgcaccactcgggggatacaatctatcagcaaaatgc
tttggatacctgaccaaacagcttatgggactggctggaggacgaattattctggctctt
gaaggaggtcatgacctgacagccatttgtgacgcatctgaagcatgtgtttctgctttg
ctaggaaatgagcttgatcctattcctgaaaaaatattacagcagacagcaaatgttaat
gcagtgcattccattgagaaggtcattgaaatacacagtaagtactggcattcactccaa
cgttattcttcaacagtcagttattctttgatagacgcacagaagtgtgataatgaagaa
gcggaaactgtaacagctatggcatctttgtcagtgggagttaagccacttcctgagaaa
aacctggatgaggagcccatggaagaagatcctcttctgtag

DBGET integrated database retrieval system