KEGG   Python bivittatus (Burmese python): 103062286Help
Entry
103062286         CDS       T03091                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103062286 (SOD1)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103062286 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 159 aa AA seqDB search
MASRKAVCVLVREPVIEARVSGVIHFEQKDDGHVLVKGRIEGLTPGKHGFHVHEFGDNTT
GCTSAGPHFNPEGKTHGGPQDKERHVGDLGNVTADDSGVADVLIEDQCISLSGPHSIIGR
TMVVHDKQDDLGKGGNDESLKTGNAGARLACGVIGLAKA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcggaaagctgtttgcgtcctcgttcgcgaacccgtcatcgaggcccgggtc
agcggcgtcattcactttgagcagaaagatgatggacatgtacttgttaaaggaaggatt
gaaggattgactccagggaaacatggtttccatgtccatgaatttggggataacactact
ggatgtaccagtgcaggtcctcatttcaatcctgaggggaaaactcacggtgggccacag
gataaagaaaggcatgttggtgatcttggaaatgtgactgcagatgattctggtgttgca
gatgtgttaatagaggaccagtgtatttctctctcaggaccacattcaattattggacgt
actatggtggttcatgacaaacaggatgatctgggtaaaggaggaaatgatgagagcttg
aaaactggaaatgctggtgctcgtctagcttgcggagtgattggactagctaaggcatag

DBGET integrated database retrieval system