KEGG   Paracoccidioides lutzii Pb01: PAAG_02725Help
Entry
PAAG_02725        CDS       T02230                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PAAG_02725
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PAAG_02725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MTTSLFRSTVGGILRVGAARMSGAAGARLITTKATLPDLSYDYGALEPSISGKIMELHHK
KHHQTYVNSYNDAVEKLAAAQEKADIKSQVAFQALTNFHGGGHVNHTLFWENLAPKSAGG
GEPPAGSLGKAVDDAFGSYDRFKSTFNTALAGIQGSGWAWLVEDKQTGKIAIKTYANQDP
VIGQFKPLLGIDAWEHAYYLQYENRKAEYFNAIWNVVNWKAAEKRFA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctcttttccggtcaactgtcggcggcatccttagagttggtgctgctaga
atgtcaggggctgcaggagcccgcttgatcacgactaaagcaaccctccctgacttatca
tacgattacggtgccctcgaaccctccatctctggcaagatcatggaactccaccacaaa
aagcaccaccaaacctacgtaaactcctacaatgatgccgtcgagaagctggccgccgcg
caggagaaggccgatatcaaatcccaggtggcttttcaagccctgaccaatttccacggc
ggtggccacgtcaatcacaccctcttctgggagaacttggctcccaagagcgctggaggc
ggcgagccgcctgccggttccctggggaaggccgttgatgatgcctttggcagctatgat
aggttcaagtctacgtttaacaccgcgctggcggggatccaggggagcgggtgggcgtgg
ttggttgaagataagcagactgggaagattgcaattaagacttatgctaaccaagacccc
gtcattggtcaattcaagcccctcttgggcattgatgcttgggaacatgcctactatctc
caatacgaaaaccgcaaagcagaatacttcaatgccatctggaacgttgtgaactggaag
gctgctgagaagcgattcgcttaa

DBGET integrated database retrieval system