KEGG   Pseudomonas balearica: CL52_09565Help
Entry
CL52_09565        CDS       T03573                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pbm  Pseudomonas balearica
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pbm00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CL52_09565 (ligD)
Enzymes [BR:pbm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CL52_09565 (ligD)
DNA repair and recombination proteins [BR:pbm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CL52_09565 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2062899..2065436
Genome map
AA seq 845 aa AA seqDB search
MPLEEYNRRRDFAATPEPSGTPRRTGRAKARALQFCVQKHDATRLHYDFRLELDGTLKSW
AIPKGPSLDPKVRRLAVHVEDHPLDYATFEGRIPDGHYGAGEVIVWDRGIWIPQGDAAEA
YRKGKLKFELQGEKLAGVWNLVRTHMQGDKEQWFLIKSNDEQARPQSEYDIVAEQPDSVL
SERTLIPRRRGAAKPAAAPPSKGTGRRKSKAAAPALPEGAVPAELPASFKPQLATLVESV
PEGDWRYEIKFDGYRLLARIEGERVQLFTRNGHDWTAKMPRQAEALAGLGLDSAWLDGEV
VVLGEEGAPDFQALQNAFEAGRSGSILYYLFDAPYLDGHDLRQVPVEERRALLARLLERS
DSELLRFSADFSEQPESILESACQMRLEGLIGKRAGSSYVSRRSNSWVKIKCKNRQEFII
VGYTEPKGARSGFGALLLGLHDDDGKLQYAGKVGTGFNQATLKSLHAKMRPLETERSPLA
KAPPAADVRGAHWLEPQLMCEVAYAEMTRQGVVRHSVFHGLRSDKPAKAITREVARTAPA
RQGTSDALAATRVRISNPERVIDPAIGATKLELARFYAEVAPWALPHLQRRPLALVRAPE
GIDGELFFQKHADKLSIPHITQLDPSLYPEHAPLLVIESAKALVGAAQMGTVELHTWNAK
APALDHPDRFVLDLDPDPALPWKRMLEATQLTQTLLDEIGLESYLKTSGGKGMHILVPLR
PVHGWAEVKAFSQAVARYLAKLLPQHFSAVSGPKNRIGKIFIDYLRNSQGASTVAAFSVR
AREGLPVSVPIAREELPELRGANAWTVRNLLPRLEELGREDPWEGFWNSEQQISAEMRER
LGMKD
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgccactggaagaatacaaccgcaggcgtgacttcgccgcgacccccgagcccagcgga
acgccgcgtcgcaccgggcgtgccaaggcgcgggcgctgcagttctgcgtgcagaagcat
gacgcgacgcgcctgcactacgacttccgcctggaactcgatgggacgctaaagagctgg
gcgattcccaaggggccgagcctggaccccaaggtccggcggctggcggtgcacgtcgaa
gaccatccgctggattacgccaccttcgaggggcgcatcccggacgggcactatggcgcc
ggggaggtgatcgtctgggatcgcggtatctggattccacagggcgacgccgccgaggcc
tatcgcaagggcaagctcaagtttgaactgcagggcgaaaagctcgccggcgtgtggaat
ctggtgcgcacgcacatgcagggcgacaaggagcagtggttcctgatcaagtccaacgac
gagcaggcaaggccgcaaagcgagtacgacatcgtcgccgagcagcctgacagcgtgctc
agcgagcgcacgctgattccccgtcgccgcggtgcggccaagcctgcggcggcgcccccc
agcaaggggacaggccggcgcaagagcaaggcggccgcgccagcgctgccggagggcgcc
gtgcccgccgaactgccggcgagtttcaagccgcagctggcgacgctcgtcgaatccgtg
cccgagggcgactggcgctacgagatcaagttcgacggctaccgcctcttggcgcgtatc
gagggcgagcgggtgcagctgttcacccgtaatggccacgactggacggcgaagatgccg
cggcaggccgaagcgctggccgggctcgggctggattcggcctggctggacggcgaggtg
gtggtgctgggcgaggagggcgcacccgacttccaggcgctgcagaacgcgttcgaggcc
gggcgcagcggcagcatcctctactacctgttcgatgcgccctatctggacggccacgac
ctgcgccaggtgccggtcgaagagcgccgagcgctgctggcccggttgctcgagcgcagc
gacagcgagctgctgcggttttccgccgacttcagcgagcaacccgagagcattctcgag
agcgcctgccaaatgcgtctggaagggttgatcggcaagcgtgcggggagcagctacgtg
tcccgccgcagcaacagctgggtgaagatcaagtgcaagaatcggcaggaattcatcatc
gtcggttataccgaacccaagggcgcgcgcagcggtttcggggcgctgctgctgggtctg
catgacgatgacggcaagctgcagtacgccggcaaggtcggcaccggcttcaatcaggcg
acgctgaaaagcctgcacgccaagatgcggccgctggaaaccgaacgctcgccgctggcc
aaggcgccgccggccgcggatgtgcgcggggcgcactggctcgaaccgcagctgatgtgc
gaagtggcctacgccgagatgacgcgccagggcgtggtgcggcattcggtgttccatggg
ctgcgctcggacaagccggccaaggcgatcacccgtgaggtcgcccgcacggcgcccgcg
cggcagggcaccagcgatgcgctggcagccacgcgcgtgcgcatcagcaacccggagcgg
gtcatcgacccggcgatcggcgcgaccaagctcgaactcgcgcgcttctacgccgaagtg
gcgccctgggccctgccgcacctgcaacggcggccgctggcactggtgcgcgcgccggaa
ggcatcgacggcgagctgttcttccagaagcacgccgacaagctgagcattccgcacatc
acccagctcgatccatcgctgtaccccgagcatgcgccgctgctggtgatcgagagtgcc
aaggcgctggtcggcgccgcgcagatgggcacggtcgaattgcatacctggaatgccaag
gcgccggcgctggaccacccggaccgcttcgtcctcgacctcgacccggacccggcgctg
ccgtggaagcgcatgctcgaagcgacccagctgacccagacgctgctcgacgagattggc
ctggagtcctatctaaagaccagtggcggcaagggcatgcacattctggtgcccttgcgc
ccggtgcatggctgggcggaggtcaaggccttcagccaggccgtggcgcgctacctggcc
aagctgctgccgcagcatttctctgccgtcagcggaccgaagaaccggatcggcaagatc
ttcatcgactacctgcgcaacagccagggtgcgagcacggtcgcagcattttccgttcgc
gcgcgtgaaggcttgccggtgtcggtgcccatcgcgcgcgaggaactgccggaactgcgc
ggggccaacgcctggacggtgcgcaatctactgccgcggctggaagaactggggcgcgaa
gacccctgggaagggttctggaacagcgagcagcagatcagcgccgagatgcgcgagcga
ctcggcatgaaggattaa

DBGET integrated database retrieval system