KEGG   Paracoccidioides brasiliensis Pb18: PADG_00971Help
Entry
PADG_00971        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PADG_00971
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PADG_00971
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADG_00971
   00430 Taurine and hypotaurine metabolism
    PADG_00971
Enzymes [BR:pbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PADG_00971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MPSKDATTASGSDLLERSEEVRNLLNAVQERLVSFIRAADHDDFSSSKAGDAPRHPSALV
QYVKPEELQATMNLQIPSFGEGQRGLLRILDQVLQYSVNTWHQGFLDKLYASTNAPGLAA
ELIIAALNTNVHIYQVSPALTVIEKFTSKQLAHLFGFDGPNSGGISVQGGSAANATSIVI
ARNTLFPETKKDGCDGSKFVIFTSTHGHYSIKKAAWMLGFGGSAVWSVPVDEKGQMIPQS
LEELVIKAKNEGRTTFYVNATAGTTVLGSFDPLEHIASICRKYNLWLHVDASLGGSFAFS
KKKRGKLAGSHLADSLTVNPHKMLGVPVTCSFLLGADMTQFHRANTLPAGYLFHDDSLES
GLNGNDVKCPEVWDLADLTLQCGRRADSLKFYLSWIYYGSEGYEQKIDSACDVAADLAAA
ISNSPNLILISENPPPCLQVAFYYAPNKQLVFPRGKKVGGKQLDEEERGKRNSNITQEIS
KRLVSRGFMIDYAPPPEGDPSAGDGKFFRCVVNVQTKKETVEALLAAILDIGPGVVKQSA
RGDSIDDPDLYAGAEPFRMGNPAEYGHGPVAHTPDLFAGAKPFRMGNPAEHGHGPVHQIH
ISN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaaagatgccacgactgcttcaggaagtgacttgctggagaggagcgaggaa
gttcgaaatctattgaacgctgtccaagaacgacttgtatcgtttatacgggctgcagat
cacgatgatttcagctcttccaaggctggagacgctccccgccacccttctgccttagta
caatacgtgaaaccagaggaattgcaagctactatgaatctccaaattccatcctttggt
gagggccaacgcggtcttcttcgaatcttagaccaagtgctgcagtattcggtcaacaca
tggcatcaggggtttctggacaagctatatgcgtctaccaatgctccaggattagcggca
gagttgatcatcgctgcactaaatacgaatgttcatatatatcaagtgtcgcctgcgttg
accgttattgaaaagtttacttcgaaacagctggcacacctttttggcttcgacgggcct
aactctggcggaatatctgttcagggaggttctgctgccaatgctacttcgattgtcata
gcccggaatactctatttccagagaccaagaaggatggctgtgacggatctaaatttgtt
atattcacgagcactcacgggcattattctataaagaaggcagcctggatgcttggattt
ggaggcagcgcggtttggtctgttcctgttgacgaaaagggacagatgattccccagtcc
cttgaagagcttgtcatcaaggcaaagaatgaaggcaggacaacgttttatgtcaatgcg
accgcagggacaacggtacttggatcgtttgaccccttggaacatattgcgtcgatttgt
cggaaatataacctctggttgcatgttgatgcctccttgggcggttcgtttgcattctcc
aagaaaaaaagaggaaaacttgctggcagccatttagcagatagtcttaccgtaaacccg
cacaaaatgctaggtgtaccggtgacttgttcatttcttcttggcgcagacatgacacaa
ttccaccgcgcaaatacactcccggcaggctatctattccacgatgattctttagagtcc
gggttgaatggcaacgacgtgaaatgcccagaggtctgggaccttgccgacctgacgtta
cagtgtggccgccgagctgactccctcaagttctacctgagttggatttactatggctcg
gagggttatgaacagaaaatcgattccgcctgtgatgtggccgctgatcttgcggcagct
atttccaactcgccaaaccttattcttatcagcgagaacccacccccatgcctccaagtt
gccttttattatgctcccaacaaacaactcgtcttcccccgagggaagaaagtaggcggt
aaacaattggatgaggaggaacgaggaaagcgaaatagcaatataacacaagaaatatca
aaaaggctagtcagtcgaggattcatgatcgactatgcaccgccaccagaaggcgatcca
tcggctggtgacggtaaatttttcaggtgtgtggttaacgtccagacaaagaaagagacc
gttgaagctctgttggctgctattttggacattgggccaggggttgttaaacagagtgct
cgtggggatagcattgatgaccctgacctgtatgcgggcgcggaaccatttcgtatggga
aatccagccgagtatgggcatggaccagtggcacatacccctgacctttttgcgggagcg
aagccattccgtatgggaaaccctgcggaacacgggcatggacctgttcatcaaatacat
atatctaactag

DBGET integrated database retrieval system