KEGG   Paracoccidioides brasiliensis Pb18: PADG_04450Help
Entry
PADG_04450        CDS       T03549                                 

Definition
(RefSeq) histone deacetylase RPD3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Brite
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PADG_04450
Chromosome [BR:pbn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PADG_04450
   HDAC complexes
    Sin3A-HDAC complex
     PADG_04450
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PADG_04450
  Chromatin remodeling factors
   NuRD complex
    PADG_04450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 689 aa AA seqDB search
MSTSFAPLDLGIANGPTDRKRVAYFYDSDVGNYAYVAGHPMKPHRIRMAHSLVMNYGLYK
KMEIYRAKPANKFEMTQFHTDEYIDFLAKVTPDNMDSYVKEQSRYNVGDDCPVFDGLFEF
CGISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQR
VLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGAGKHYAVNFPLR
DGIEDISYKGIFEPVIKHVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVKYVR
SFGIPTMIVGGGGYTMRNVARTWCFETGILVGEQLGTELPYNDYYEYFSPDYELDVRPSN
MDNANSKEYLDKIRMQVIENLKRTAFAPSVQMTDVPRGPLIDGMDDEADAILDDLDEDEN
KDRRFTKRRFDQYIEKEGELSDSEDEEEAAANGIRPQPGVIKRRNQVNYRNLDGDSGVDS
GLATPREESSIPDDDAGLDDKMEDVEETETQEKATPSPEEPTTRSESRMDADDISEGNGV
ALPDAAAAVADEEQQEEEPLASKAILTHASALPENADLEDTMMEDAPPEEPATKDSTEAP
ISAPVPKEESRESSRPKSPAIGTPTPAVTLTPASAAAPVTASHPSEPAAGAEALETVTTK
AAEADIFSKRESSPHGDEKKEKREDDQMA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgtcgttcgcccctctcgacctgggcatcgccaacgggcccacagacaggaag
agggtcgcctacttctacgattcagatgtgggcaactacgcctacgtcgcgggccatccc
atgaaaccccatcgcattcggatggcccatagcttggtcatgaactacggtctatacaag
aagatggaaatataccgagcaaaaccagcgaacaaattcgaaatgacacagtttcacacg
gatgaatatattgactttctcgcgaaagttacacccgataacatggattcatacgtgaag
gaacagagtagatacaatgtcggtgatgactgtcctgtttttgatggcctcttcgagttc
tgcggaatcagtgccggaggcagtatggaaggtgcagcgcgcctcaaccgaaataaatgc
gacatcgcagtcaactgggctggaggccttcaccacgcgaaaaagagcgaagccagtggc
ttctgctatgtaaatgatattgtgcttggtatcctcgagttgctccgtttcaaacaaaga
gttctttatgtggatatcgacgtccatcatggagatggagtggaagaagccttttacact
acggacagagtcatgactgtgtccttccataaatacggagaatacttccctggaaccggt
gaattacgtgatatcggcgtcggtgctggtaaacactatgccgtaaattttccgctgcga
gatggtattgaagatataagctataaagggatttttgagccggtcattaagcatgttatg
gaatggtatcgtcccgaagccgtcgtgctccaatgcggcggagacagtttgtctggagac
cgacttggttgctttaatctgagtatgagagggcatgcaaattgcgtaaaatacgtgagg
agttttggtattcccaccatgatcgtcggtggcggcggttacaccatgagaaacgttgcg
agaacctggtgttttgaaactggaattctagttggcgagcagctggggactgagttgcca
tataacgactactatgagtacttttctcccgattacgaacttgacgtccgaccgtcgaac
atggataacgccaattccaaagagtatctcgacaagattcgaatgcaggttattgaaaac
ctgaagcgcactgctttcgcaccatctgtgcagatgacagacgtccccagaggcccatta
attgacggcatggatgacgaggctgatgccatcttagatgatcttgatgaggacgagaat
aaagacagacggtttaccaagcggcggttcgaccaatacatcgagaaggaaggtgaatta
agtgacagcgaggacgaagaagaagcggctgccaacggcatccgcccgcagcccggtgtc
atcaagcgacggaaccaggtcaactaccgaaacctcgacggtgattccggtgttgatagt
ggccttgccactccgcgggaagaatcgtcgataccagatgatgatgctggtcttgatgat
aagatggaagatgtcgaagaaactgaaacgcaagagaaggcaacgccgtctcccgaagag
ccgacaactcgatcagaatcaaggatggatgcagatgatatctccgagggcaatggggtc
gcgttgccagacgctgcagctgctgtcgctgacgaagagcagcaggaggaggagccattg
gcgtcaaaagccatattaacccatgcatcagctctgccggaaaatgccgacttggaggac
acgatgatggaagacgcgcccccggaagaacccgccaccaaggactccacggaggcacca
atatctgcacctgtacccaaggaggagtcgcgtgaatcatcgcgacccaaatcacctgca
attggaacccccacgcctgctgtgactcttactcccgcatctgctgccgctcccgtgaca
gcttctcacccatctgagcccgctgctggagcagaggcgttggaaacagtcacgaccaaa
gccgctgaagccgacatattttcgaaaagagagtcgtctcctcatggtgatgagaagaag
gagaaaagggaggatgatcaaatggcataa

DBGET integrated database retrieval system