KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_25280Help
Entry
PACID_25280       CDS       T02345                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Brite
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PACID_25280 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AFV90304
UniProt: K7RQL4
LinkDB All DBs
Position
2670958..2671578
Genome map
AA seq 206 aa AA seqDB search
MAVYTLPDLDYDYGALEPHISGQIMQLHHDKHHQTYVTGANTALEKLEEARAKGDFGAIN
KLEKDLAFNLGGHINHSVFWKNMSPDGGGRPEGNELAAAIDEYFGSFEGFQKQFNEAAKG
LQGSGWGILAWDALGQRLNTFQLFDQQGNLPTSQIPIVQLDMWEHAYYLQYQNVKANYVD
AWWNVVNWADATARFDRARTQTAGLI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacacccttcccgatctcgactacgactacggcgctctcgagccccatatc
tcgggtcagatcatgcagcttcaccacgacaagcatcaccagacctacgtgacgggcgcg
aacaccgccctggagaagctcgaggaggcgcgcgccaagggagacttcggcgccatcaac
aagctcgagaaggatctcgccttcaacctcggcggccacatcaaccactcggtgttctgg
aagaacatgtcccccgacggcggcggacgccccgagggcaacgagctggccgcggcgatc
gacgagtacttcggctccttcgaggggttccagaagcagttcaacgaggccgccaagggc
ctccagggctccggctggggaatcctcgcctgggacgccttgggtcagcgactcaacacc
ttccagctcttcgaccagcagggcaacctgccgacgagccagatcccgatcgtccagctg
gacatgtgggagcacgcctactacctgcagtaccagaacgtgaaggcgaactacgtcgac
gcctggtggaatgtcgtcaactgggccgacgcgaccgcccgcttcgaccgggccaggact
cagaccgcgggtctgatctga

DBGET integrated database retrieval system