KEGG   Parvularcula bermudensis: PB2503_03782Help
Entry
PB2503_03782      CDS       T01298                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pbr  Parvularcula bermudensis
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PB2503_03782
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PB2503_03782
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    PB2503_03782
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PB2503_03782
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PB2503_03782
Lipid biosynthesis proteins [BR:pbr01004]
 Fatty acid synthase
  Component type
   PB2503_03782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
685680..686501
Genome map
AA seq 273 aa AA seqDB search
MASMDQFPSGTLLEGKRGLIMGVANKNSIAWAIAQQLKAQGAELCFSYIEAMESRVRPLA
DEIGVDFLVPCDVTQDDSMAACFGAIEEKWGKMDFLVHSIAFSDKEELKGSFVENTTREN
FKQSLDISAFSFVDAAKRASKLMPDGGSMITLTYLGSERVIPSYNVMGVAKAALEAATRY
IARDLGPQGIRVNAISAGAIKTLSLGGISGGRSLIAEGRTWAPLREDTDPIGVAGAALYL
LSDLGKSCTGEVHHVDAGFHIVGMPDPEALKGD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcatctatggaccagtttccaagcgggaccctccttgagggcaaacgcggtctcatc
atgggggtcgccaacaagaactcgatcgcctgggccatcgcccagcaattgaaggcacaa
ggggctgagctgtgcttttcctatatcgaagccatggagtcgcgggttcgccctctggcc
gatgagatcggcgtcgacttcctcgtgccctgtgacgtcacccaggacgactcgatggcc
gcctgttttggtgccatcgaagagaaatggggaaagatggattttctcgtccactccatc
gctttttccgacaaggaagaattgaagggctcctttgtcgagaacacgacgcgggaaaat
ttcaaacagagcctcgatatctccgccttcagtttcgtcgatgcggccaagcgggcctcg
aaattgatgcctgacggcggctcaatgattacgctcacttatctcggctccgaaagggtt
attccctcctataatgttatgggggttgccaaggcggcgcttgaggcggcgacccgctat
attgcgcgggatttgggtccccaggggatccgggtgaacgccatctccgctggggccatt
aagacgctgtctctgggcggcatttcaggcggccggtcactgatcgccgaaggtcggacc
tgggcaccgctgagggaggacaccgaccccatcggtgttgcgggcgcggctctctatctg
ctctcggatctcggcaaaagctgcaccggagaggtgcaccatgtcgatgccggcttccac
attgtgggcatgcccgaccccgaggcgctcaaaggcgactaa

DBGET integrated database retrieval system