KEGG   Pseudomonas corrugata: AXG94_14930Help
Entry
AXG94_14930       CDS       T04842                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00010  Glycolysis / Gluconeogenesis
pcg01100  Metabolic pathways
pcg01110  Biosynthesis of secondary metabolites
pcg01120  Microbial metabolism in diverse environments
pcg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXG94_14930
Enzymes [BR:pcg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AXG94_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AOE63000
UniProt: A0A1B3CD93
LinkDB All DBs
Position
3441388..3442287
Genome map
AA seq 299 aa AA seqDB search
MPTPNVEAVKLDELNGWRIRHGQAELLVAQQGAHILSYQVDGQPPLIWLNDQATFKAGKS
IRAGVPVCWPWFGNLTRNPDSVQAMRVSNEPATAHGLVRAMDWELKGIEAEGEGLKVEFV
LPYPENGLAGWPHQVDLTLTIVMDAQLHISLTSHNRGSETVSLSQALHSYFAVSDVRNVH
VEGVAGLNYIETLDDWKTATQAGDLHFAGETDRIYLDTPATLSIVDPHWERRIELTSSGS
RSAVIWNPWTERAKAFSDMADDGWQRMLCIETANVMHDVVTLLPKASHTLGVSITSKPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcccaacgtcgaagccgtcaaactggatgaactcaatggctggcgtatccgc
cacggccaggccgagttgctggtggcccagcagggcgcgcatattctcagctaccaagtg
gatggccagccgccgctgatctggctcaatgaccaggcgaccttcaaggctggcaagagc
atccgcgccggtgttccggtgtgctggccatggttcggcaacctgacacgcaaccccgac
agcgtccaggccatgcgcgtgagcaacgagccggccaccgctcacggcctggtgagggcg
atggattgggaactgaaaggcatcgaggccgagggcgaaggcctgaaagtcgaattcgtg
ttgccctatcccgaaaacggcctggcgggctggcctcatcaggtcgacctgacgctgacc
atcgtgatggacgcgcaactgcatatcagcctcaccagccataaccgcggcagcgaaacc
gtcagcctcagccaggcgctgcacagctatttcgccgtgagcgacgtgcgcaacgtgcat
gtcgaaggtgtggccggcttgaactacatcgagaccctggatgactggaaaaccgccacc
caggccggcgacctgcactttgccggcgagaccgaccgtatctatctcgataccccggcg
acactgagcatcgtcgacccacattgggaacggcggatcgaactgaccagcagcggctca
cgctcggcggtaatctggaacccctggacagaacgcgccaaggccttcagcgacatggcc
gacgatggctggcagcgcatgctgtgcatcgaaacggcgaacgtgatgcacgatgtggtg
acgttgctgcccaaggccagtcataccctgggtgtgagcatcactagcaaaccgctctaa

DBGET integrated database retrieval system