KEGG   Pseudomonas chlororaphis PA23: EY04_21235Help
Entry
EY04_21235        CDS       T03201                                 

Definition
(GenBank) peptide synthase
Organism
pch  Pseudomonas chlororaphis PA23
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4719483..4732499)
Genome map
AA seq 4338 aa AA seqDB search
MMDAFELPSTLAQALQRRAAQTPDQVALRFLAEEQDQSVVLSYRDLDLRARTIAAALQAN
AGLGDRAVLLFPSGPDYVAAFFACLYAGVIAVPAYPPESSRRHHQERLISIIADAEPRLL
LTSSGLRDSLAQMDELQGADAPQLLCVDTLEASLAEVWTATELRGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPAYFLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSE
PIRLDTLERFAEKFAACGFTPNNFFASYGLAEATLFVAGGTRGQGIPALRLDEQALAQNR
AEPGTGNAMMSCGTSQPEHAVLIVEPHTLVELEDNLVGEVWAAGPSIAHGYWRNPEASAK
TFVQHAGQTWLRTGDLGFMRGGELFITGRLKDMLIVHGHNLYPQDIEQTIEREVEVVRKG
RVAAFAVTEQGEEGIGIAAEISRSVQKILTPEALIKLIRQTVAEAYQQAPSVVVLLNPGA
LPKTSSGKLQRSACRNRLADGSLDSYAQFPSRQAAIDEASGEASSELQELIGRIWREQLH
VEQVASDDHFFLLGGNSIAATQVVARLREELGLELNLRLLFEAPTLGAFAAQVAQLQQDG
GLAQGAINALSRAEALPQSLAQNRLWITWQLDPHSSAYNIPGGLRLRGELDEDALRASFQ
QLIERHESLRTRFFERDGQALQQVEAAGEFNLQVIDLSDLPLAEREARAQQIREEEARTQ
FDLEQGPLLWVTLVRLDDEEHQLLVTLHHIIADGWSLNVLIDEFSRLYAAAVQGQAASLA
PLPLQYADYGSWQRQWLAQGEGERQLAYWKQQLGDEHPSLSLATDHPRSAQRQHSAARHS
LRLGASLSEAIRQTAQAHESTPFMLLLTAFQSLLHRYSGQRDIRIGVPNANRPRLETQGL
IGFFINTLVLRAEVDGRLPFSALLAQTRQAALEAQAHQDLPFEQLLEAFPQAREQGLFQV
MFNHQQRDLGALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLSFDYAAELFEAA
TVERLAEHFVSLLREACERPQTAIADLPLLNPCEQAQQQQWSEAPCAAASQWLPELLDAQ
LQQTPERTALVWQGGELSFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLA
IVKAGGAYVPLDPDYPAERLAYMLVDSGVELLLTQTQLLERLPQAEGVSAIAMDSLKLDS
WPSHAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALSERLQWMQNTYRLDASDVLMQK
APISFDVSVWECFWPLITGCRLLLAAPGEHRDPHRIAQLVQQYGVTTLHFVPPLLQLFVD
EPLSAECSSLRWLFSGGEALPAELRDRVLEQLPNVQLHNRYGPTETAINVTHWHCRRSDG
ERSPIGRPLGNVICRVLDTDLNPVPAGVPGELCIAGIGLARGYLGRPGLSAERFVVDPLG
SEGARLYRTGDRVHWAADGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQEGVAQAAVLV
RETAAGAQLIGYYTATADVEDEEVQIARLKTALASELPEYMVPAQLMLLSAMPLSPSGKL
DRRALPEPQWQVREHVEPVTELQQQIAAIWREVLGQQRIGLRDDFFALGGHSLLATQIIS
RTRQACDVELPLRALFEASELGDFAEQVRLIQASGKRNQQPPIAKVDRSAPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARFKGVLDVGRFEAALQALILRHETLRTTFPSVDGVARQRV
HGETGVRMAWKDFSKLDAAAREQRLQQLADSEAHQPFDLETGPLLRACLVKAAEHEHYFV
LTLHHIVTEGWAMDIFARELSALYEAFIDDRDSPLEPLPVQYLDYSVWQRQWLESGERQR
QLDYWTTQLGNEHPLLELPGDRPRPPVQSHQGELYRFDLSDELAARVRRFNAEHGLTLFM
TMTATLAVLLYRCSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELF
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRSLAGMTVE
YLANDARATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAAHWRNLLEALIESPEQ
RLSELPLLDRAEQQQLLDSLGVEPGEHRLDQRIHHLFSEQALLRPNAPALTFAGQTLSYA
ELDSRANRLAWMLRERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRL
HYMIEDSGIGLLLSDAAMFQALGQLPPSVARWCLEEDGAQLANYPAGELPFISLPQHQAY
LIYTSGSTGKPKGVVVSHGEIAMHCRAVIERFGMRPDDCELHFYSINFDAATERLLVPLL
SGAQVVLRAQGQWDTEEICQLIRQHRINILGFTPSYGSQLAQWLATQGETLPVRMCITGG
EALTGEHLSRIRAAFKPSLFFNAYGPTETVVMPLASLAPEQLEEGVGSVPIGTVVGERVA
YILDADLALLPQGATGELYVGGAGLAQGYHQRPGMSAERFVADPFSAKGGRLYRTGDLVR
QCADGQVEYIGRVDHQVKIRGFRIELGEIENRLLEHEAVREAVVLALDMSGGKQLAGYLV
TDVAEQSDEQQAALREAIKAQLKIHLPDYMVPTHLVLLASMPLTANGKLDRRALPAPDLE
LNRQQYVAPSNELEQTLAQVWCDVLNLPQVGLHDNFFELGGDSILSIQVVSRARQLGIHF
SPRDLFQHQTVQTLAAVASRSEQIVAEQGVLSGESGLTPIQHWFFDSEIPERQHWNQALL
LAPTQALDGQLLEQALHAVLAQHDALRLRFTQVDGQWQAMHQPLSEAPLLVQMHVASMDQ
CVALFAEAQRSLDLSNGPLLRALLVDGPDEQQRLFIAIHHLVVDGVSWRVLLEDLQNLYR
QLEAQQTPRLPAKTSALRDWASRLLAYAGSESLREELSWWQDQLAGPAATLPVQHTQGGR
QNKHARTVSVKLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWTGEASALIQLEGH
GRETLFDEIDLTRTVGWFTSAYPLRLTPQAIEEAAGQGASIKAIKEQLRAVPHKGLGYGV
LRYLADAAIQQGMAALPKAPITFNYLGQFDQSFASDALFRPLDEPVGAAHSPEAPLPNEL
SVDSQVYAGELVLRWTFSSERFDPQTIDELAQAYLGELHCLIAHCLEDDAGGLTPSDFPL
ARLTQAQLDALPVAAGVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPAR
FAQAWQAVVARHEALRASFCWNVGEDMLQVIHKPGGTSIEFLDWSLVAEAEQEPKLQALL
KSEREAGFDLLEQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYTALGE
GREAQLSVPPRYRDYIGWLQRQSLAEARQWWKNNLQGFERTTSIPSDRPFLREHAGDSGG
MIVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRLSGERDVLFGVTVAGRP
VEMPEMQRTVGLFINSIALRVKLPEDGQRLSVRQWLGGLLERNMELREYEYLPLVAIQEN
SELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLH
LSYDQRYFEQATIERMLGEFKRLLLALVQGFHGDMAELPLLGAEEQDFLLAGCNQSEHDY
PLERSYVELFEAQVAAHPQRIAASCQELQYSYTELNQRSNRLGHALIANGVGLDQPVALL
AERSLDLLGMIIGSFKAGAGYLPLDPGLPSQRLGRIIELSRTPLLVCTAACQAQAQALLD
EFACANRPRLLVWEEVQAADHSLDNPGIYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLN
NQLSKVPYLQLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLAHV
QAQRITVLESVPSLIQGMLAQESIHLDGLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAY
GPAECSDDVAFYRVDMASTRGSYLPIGTPTDNNRLYLMDGALDLVPLGAVGELCVAGTGV
GRGYVSDPLRTAQVFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGYRIE
LGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVASDSALNPTERLERIKQRLRAELPE
YMVPLHWLWLERLPLNANGKLDRKALPALEIGQLHSQDYLAPRSELEQTLAAIWAEVLKV
ERVGVRDNFFELGGHSLLATQIASRVQKTLQRNVPLRAMFECSTVEELAQYIDSLASSEI
SEEKVDRLSDLMAELEGL
NT seq 13017 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgcgttcgaactccccagcactctggctcaagcccttcaacgccgggcggct
cagacccccgatcaagtggccttgcgctttcttgccgaagagcaggatcagagcgtggtc
ctcagttatcgcgacctggatctgcgcgcccggaccatcgccgcggcgctgcaggccaat
gccggtctgggcgatcgcgcggtgctgctgttccccagcggcccggactatgtcgcggcg
tttttcgcctgcctgtatgccggggtcatcgcggtgccggcctatccgccggagtcgagc
cgacgccatcaccaggagcggctgatctcgatcatcgccgacgctgagccgcggctgctg
ctgaccagcagcgggctgcgcgattccctggcgcagatggacgagctacaaggcgccgac
gcgccgcagctgctctgcgtggacaccctggaggcgagcctggccgaagtctggacggcc
accgaactgcgcggcgacgacatcgccttcctgcaatacacctcgggttccaccgccttg
cccaagggcgtgcaagtcagccacggcaacctggtggccaacgaactgctgatccgccgc
ggcttcggcatcgacctcaaccccgacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcctgctgcaaccgatcttcagcggtgtgccctgcgtattg
atgtcgccggcctacttcctcggccggccgttgcgctggctggaggcgatcagcgaatac
ggcggcaccatcagcggcggcccggacttcgcctaccgcctgtgcagcgagcgggtcagc
gagtcggccctggagcgcctggacctcagtcgctggcgcgtggcctattccgggtccgag
ccgatccgcctggacaccctggagcgcttcgccgagaagttcgccgcctgcggtttcacc
ccgaacaacttctttgcctcttatggcctggccgaagccaccctgtttgtcgccggcggc
acccgtggccagggcatcccggccctgcgcctggacgagcaggccctggcgcagaaccgc
gccgagccgggcaccggcaacgccatgatgagctgcggcaccagtcagcccgagcacgcc
gtgctgatcgtcgagccgcacaccctggtcgagctggaagacaatctggtcggcgaagtc
tgggccgccggcccgagcatcgcccatggttactggcgcaaccccgaggcgtcggccaag
accttcgttcagcacgccggccagacctggctgcgcaccggcgacttgggtttcatgcgc
ggtggcgagctgttcattaccggtcgcttgaaagacatgctgatcgtgcatggccacaac
ctttatccacaggacatcgagcagaccatcgagcgtgaggtcgaggtggtgcgcaagggc
cgggtcgcggcgttcgccgtcaccgaacagggcgaggaaggcattggtatcgccgcggaa
atcagccgcagcgtgcagaagatcctcacgccggaggcgctgatcaagctgattcgccag
accgtggccgaggcctatcagcaagcgccgagcgtggtggtcctgcttaaccccggcgcg
ttgcccaagacctccagcggcaagctgcaacgttcggcctgccgcaaccgcctggccgat
ggcagcctcgacagttatgcccagtttcctagtcgccaggcggcgatcgacgaggccagc
ggcgaagcgagcagcgaactgcaagagctgatcggccgcatctggcgcgaacagctgcat
gtcgagcaagtggcgagcgacgatcactttttcctgctgggcggcaactccatcgccgcg
acccaggtcgtcgcgcgcctgcgtgaagaactcggcctggagctgaacctgcgcctgctg
ttcgaggcgccgaccctcggcgctttcgccgcgcaggtcgcgcaattgcaacaggacggc
ggcctggcccagggcgcgatcaatgccttgtcgcgtgccgaggcgctgcctcagtccctg
gcgcagaatcgcctgtggatcacctggcagctcgacccgcacagcagcgcctacaacatt
cccggcggcctgcgcctgcgcggcgagctggacgaagacgccctgcgcgccagcttccag
caactgatcgagcgtcatgaatccctgcgcacgcgctttttcgagcgcgacggccaggcg
ctgcaacaggtcgaagccgccggcgaattcaacctgcaggtgatcgacctcagcgacttg
ccgctggccgagcgcgaggcgcgggcgcaacagatccgcgaggaggaagcccgtacccag
ttcgacctggaacaaggcccgctgctctgggtgaccctggtgcgcctcgacgacgaagag
caccaactgctggtgaccctgcaccacatcatcgccgatggctggtcgctgaatgtgctg
atcgacgagttctcgcgcctgtatgccgccgccgtgcaaggccaggcggcgagcctggcg
ccgttgccgctgcaatacgccgactacggcagctggcagcgccagtggctggcccagggc
gaaggcgagcggcaactggcctactggaaacagcagttgggcgatgagcacccaagcctg
agcctggccaccgatcacccgcgctcggcgcagcggcaacacagcgccgcgcgccacagc
ctgcgcctgggggcgagcctgagcgaagccatccgccagaccgcccaggcccatgaatcc
acacctttcatgctgttgctcacggcgttccagagcctgctgcatcgctacagcggccag
cgcgacatccgcatcggcgtgcccaacgccaaccgtccgcgcctggaaacccagggcctg
atcggctttttcatcaacaccctggtgctgcgcgccgaggtggatggtcgcctgccattt
agcgcgttgctggcgcagacccgccaggccgcgctggaagcccaggcccatcaggacctg
ccgttcgagcaactgctcgaagccttcccccaggcccgcgaacagggtctgttccaggtc
atgttcaaccaccagcaacgcgacctcggcgccctgcgccggttgcccgggctgctggcc
gaagagctgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaagaa
gaccgcaacggccgcctgagcctgtccttcgactacgccgccgagctgttcgaggccgcg
accgtcgagcgcctggccgagcatttcgtcagcctgctgcgcgaggcctgcgagcgtccg
cagaccgccatcgccgacttgccgttgctcaacccctgcgagcaggcgcagcagcaacag
tggagcgaagccccttgcgcggcggccagccaatggctgcccgagctgctcgacgcacaa
ctgcaacagaccccggagcgcaccgcgctggtgtggcagggcggcgagctgagcttcgcc
gagctgcatgcccaggccaaccgcctggcccattacctgcgcgacaaaggggtcggtccg
gatgtctgcgtggccatcgccgccgagcgttcgccgcagctgttgatcggcctgctggcg
atcgtcaaggctggcggcgcctatgtgccgctggacccggactacccggccgaacgcctg
gcctacatgctggtcgacagtggcgtcgagctgctgctgacccagacccagctgctcgag
cgtctgccccaggccgagggtgtcagcgccatcgccatggacagcctcaagctcgacagc
tggccgagccatgcgccgggcctgcacctgcacggcgacaacctggcgtatgtgatctac
acctccggctccaccggtcagcccaagggcgtgggcaacacccatgcggccctgagcgaa
cgcttgcagtggatgcagaacacttaccgcctggatgccagcgatgtgctgatgcaaaag
gcgccgatcagcttcgacgtgtcggtgtgggaatgcttctggccgctgatcaccggctgc
cgcctgctgctggccgcgccgggtgaacaccgcgacccgcatcgcattgcccagttggtg
cagcaatacggcgtgaccacgctgcacttcgtgccgccgctgttgcagctgttcgtcgat
gagccgctgagcgccgaatgcagcagcctgcgctggctgttctccggtggcgaagccttg
ccggccgaattgcgcgaccgggtgctggagcaactgccgaacgtccagttgcacaaccgt
tatggcccgactgaaaccgcgatcaacgtcacccactggcattgccgccgcagcgatggc
gagcgttcgcccatcggccggccgctgggcaatgtgatctgccgggtgctggacaccgac
ctcaacccggtgccggccggcgtgccgggcgagctgtgcattgccggcatcggcctggcc
cgtggttacctcgggcggccggggctgagcgccgaacgttttgtcgtcgacccgctgggc
tccgagggcgcgcgcctgtaccgcaccggcgaccgagtgcactgggcggccgatggtgcg
ctggaatacctcgggcgcctcgatcagcaggtcaagctgcgcggcttccgtgtcgaaccc
caggaaatcgaagcgcgcctgctggcccaggagggcgtggcccaggccgcggtactggtg
cgcgagaccgcggccggtgcacagctgatcggttattacaccgccactgcggatgtggaa
gatgaggaggtgcagatcgcgcgcctgaaaaccgccctggccagcgagttgccggagtac
atggtgccggcgcaactgatgcttctttcggccatgccgctgagcccgagcggcaagctc
gaccgccgcgccttgccggagccgcaatggcaggtgcgtgaacacgtcgagccggtcacc
gaactgcaacaacagatcgcggcgatctggcgcgaggtgctggggcagcagcgcattggc
ttgcgcgatgacttctttgccctgggcggccactcgctgctggccacgcagatcatttcc
cggacccgccaggcctgcgacgtcgagttgccgctgcgggccttgttcgaagccagcgag
ctgggcgacttcgccgagcaggtgcggctgatccaggcatccggcaagcgcaaccagcag
ccgccgatcgccaaggtcgaccgcagcgcgcctgtgccgctgtcctattcccagcagcgc
atgtggttcctctggcagatggagccggacagcccggcctacaacgtcggcggcatggcg
cgtttcaagggcgtgctggatgtcgggcgtttcgaggcggcgctgcaggcgctgatcctg
cgtcacgaaaccctgcgtaccactttccccagcgtcgacggcgtggcccggcaacgggtg
cacggggaaaccggtgtgcgcatggcctggaaggatttctccaagctggatgcagcggct
cgcgagcaacgcctgcaacagctggccgacagcgaagcgcaccagccgttcgacctggaa
accggtccgctgctgcgcgcctgcctggtcaaggcggcggagcatgagcactacttcgtg
ctgaccctgcaccacatcgtcaccgaaggctgggcgatggatatcttcgcccgtgagctg
agcgcgttgtacgaagcctttatcgacgaccgcgactcgccgctggaaccgctgccggtg
cagtacctggactacagcgtctggcagcgccagtggctggagtccggcgagcgtcagcgc
cagctggattactggaccacgcaactgggcaacgaacacccgctgctggaactgccgggc
gaccgtccgcggccgccggtgcaaagccaccagggcgagctgtaccgcttcgacctcagc
gacgagctggcggcacgggtgcgccgcttcaacgcggaacacggcctgaccctgttcatg
accatgaccgccactttggccgtgctgctctatcgctgcagcggccagaccgacctgcgc
atcggcgcgccggtggccaaccgcatccgtccggaaagcgaagggctgatcggcgccttc
ctcaacacccaggtactgcgttgccagctcgacgggcagatgagcgtcggcgagctgttc
gagcaggtgcggcacaccgtgatcgaaggccagtcccatcaggacctgccgttcgaccac
ctggtggaagccctgcaaccgccgcgcagcgccgcctacaacccgctgttccaggtgatg
tgcaacgtccagcgctgggagttccagcagagccgcagcctggccgggatgacggtcgaa
tacctggccaacgatgcgcgggccaccaagttcgacctcaacctggaagtcaccgacctc
gatcatcgcctgggttgctgcctgacctacagcaccgacctgttcgacgagccgcgcatc
gcgcgcatggcggcgcactggcgcaacctgctggaggccttgatcgagagccccgagcag
cgcctgagcgaattgccgctgctggatcgcgccgagcaacagcaactgctggacagcctg
ggcgtcgagcccggcgaacatcgcctggaccagcgcatccatcacctgttcagcgaacag
gcgctgctgcgcccgaacgcgccggccctgacattcgccgggcagaccctgagctacgcc
gagctcgacagccgcgccaaccgcctggcctggatgctccgtgaacgtggcgtcggcccg
caggtgcgggtcggcctggccctggagcgttcgctggaaatggtcatcggcctgctggcg
atcctcaaggccggcggcgcctacgtgccgctggacccggaatacccgctggaccgcctg
cactacatgatcgaagacagtggcatcggcctgctgctcagcgacgcggcgatgttccag
gccctgggccagctgccgccgagcgtggcgcgctggtgcctggaagaggacggcgcgcaa
ctggccaactacccggccggtgagctgccctttatcagcctgccgcagcaccaggcgtac
ctgatctacacctcgggttccaccggcaagcccaagggcgtggtggtgtcccatggcgag
atcgccatgcattgccgtgcggtgatcgagcgcttcggcatgcgcccggacgactgcgag
ctgcacttctattccatcaacttcgatgccgccaccgagcgtctgctggtgccgctgctc
agcggcgcccaggtggtgctgcgggcgcaagggcagtgggacaccgaagagatctgccag
ctgatccgccagcaccgcatcaacatcctcggcttcaccccgagctacggcagccagctg
gcgcagtggctggcgacccagggcgaaaccctgccggtgcgcatgtgcatcaccggcggc
gaggcactgaccggcgagcacctgagccgcatccgcgcggcgttcaagccgagcctgttc
ttcaacgcctacggccccaccgaaaccgtggtcatgcctttggccagcctggcgccggaa
caactggaggagggcgtcggcagtgtgccgatcggcacggtggtcggtgagcgcgtggcc
tacatcctcgacgccgatctcgctctgttgccacaaggcgccaccggcgagttgtatgtc
ggcggggccggcctggcccagggttaccaccagcgtccgggcatgagcgccgagcgcttc
gtcgccgacccgttcagcgctaaaggcgggcgcctgtatcgcaccggcgacctggtgcgc
cagtgcgccgacggtcaggtggaatacatcggccgggtcgaccatcaggtgaagattcgc
ggcttccgcatcgagctgggggaaatcgaaaaccgcctgctggaacatgaggcggtgcgc
gaagcggtggtgctggccctggacatgtccggcggcaaacagctggccggttatctggtg
accgatgtcgccgaacagagtgacgagcagcaagctgccttgcgcgaagcgatcaaggcc
cagctgaaaatccacttgccggattacatggtgcccacccatctggtcctgctggcgagc
atgccgctgaccgccaacggcaagctcgaccgccgtgccttgccggcaccggacctggaa
ctcaaccgccagcagtacgtggcgccgagcaacgagctggagcaaaccctggcccaggtc
tggtgcgatgtgctgaacctgccgcaggtcggcctgcacgacaacttcttcgaactgggc
ggcgactcgatcctgtcgatccaggtggtcagccgcgcccgccagctgggcattcatttc
agcccgcgcgacctgttccagcatcagaccgtgcagaccctggccgcggtggccagccgc
agcgagcagattgttgccgagcaaggcgtgctcagcggcgagtcgggcctgacgccgatc
cagcactggttcttcgacagcgagatccccgagcgtcagcactggaaccaggcgctgctg
ctggcgccgacccaggcactcgatgggcagctgttggagcaagcgctgcacgcggtgctg
gcccagcatgacgccctgcgcctgcgctttacccaggtcgacggtcaatggcaggcgatg
catcaaccgttgtccgaagcgccgctgctggtgcagatgcatgtggcgtctatggatcaa
tgtgttgcgctgttcgccgaggctcagcgcagcctcgacctgagcaacggaccgctgttg
cgcgcactgttggtggacggtccggatgagcagcaacgcctgtttatcgccatccaccac
ctggtggtcgacggcgtgtcctggcgggtgctgctggaggatctgcaaaacctctaccgc
cagcttgaagctcagcagacgccgcgcctgccggcgaaaaccagcgccttgcgcgattgg
gcgtcacgcctgctggcctatgccggcagcgagtcgctgcgcgaagagttgagctggtgg
caggaccaactggctggcccggcagcgacgctgccggtgcagcacactcagggcgggcgg
cagaacaagcatgcccggaccgtcagcgtgaaactggatgccgagcgcacccggcagttg
ctgcaacaggcgccgagcgcttaccgcacccaggtcaacgacctgttgctgacggccctg
gcccgcgtactctgccgttggaccggcgaggcttcggcgctgatccagctcgaaggccac
ggccgcgaaaccctgttcgacgagatcgacctgacccgcacggtcggctggttcaccagc
gcttacccgctgcgcctgaccccgcaggctatagaggaagcggccgggcagggcgcctcg
atcaaggcgatcaaggaacagctgcgcgccgtaccgcacaaaggcctgggttatggtgtg
ctgcgctacctggccgacgcggcgatccagcaaggcatggcggccttgccgaaggcgccg
atcaccttcaactacctgggccagttcgaccagagctttgccagcgacgcgctgttccgt
ccgctggacgagccggtgggcgccgcccattcgccggaagcgccgctgcccaacgagctg
agcgtcgacagccaggtctacgccggtgagctggtgctgcgctggaccttcagcagcgag
cgtttcgacccgcagaccatcgacgagctggcccaggcctacctcggcgaactgcactgc
ctgatcgcccattgcctggaggacgatgccggcggcctgacgccgtcggacttccccctg
gcgcgcctgacccaggcgcagctggacgcgctgccagtagcagccggggtcatcgaagac
gtctacccgctgaccccgatgcaagagggcatgctgctgcacaccctgctggagccgggc
accggcctgtactacatgcaggaccgctaccgcatcaacagcgagctggacccggcgcgt
ttcgcccaggcctggcaggcggtggtggcccgtcacgaagcgctgcgcgcgtccttctgc
tggaacgtcggcgaagacatgctgcaagttatccacaagccgggcggcacgtcgatcgag
ttcctggactggagtttagtggccgaagccgagcaggagccgaagttgcaggcgctgctg
aaaagcgaacgcgaggccggtttcgatctgctcgagcaggcgccgttccacctgcggctg
atccgcgtgggggccgcgcgctactggttcatgatgagcaaccaccacatcctgatcgat
gcctggtgccgttcgctgttgatgaacgacttcttcgagatctacaccgccctgggcgaa
ggtcgcgaagcccagctcagcgtgccgccacgctaccgcgattacatcggctggctgcaa
cgccagagcctggccgaggcgcgccagtggtggaaaaacaacctgcaaggcttcgagcgc
accacgtcgattccgagcgaccggccgttcctgcgtgagcacgccggcgacagcggcggc
atgatcgtcggtgactgctacacccggctcgatgcccgcgacggtgcgcaactgcgcgag
ttggcgcagcagcatcaactgaccgtcaacaccttcgcccaggcggcctgggccctggtc
ctgcggcgcctgagcggcgagcgtgacgtgctgttcggcgtcaccgtggctgggcgcccg
gtggaaatgccggagatgcagcgcaccgtcggcctgttcatcaacagcatcgcgctgcgg
gtgaagttgccggaagacggtcagcgcctgagcgtgcgtcaatggctgggcggcctgctg
gaacgcaacatggagctgcgcgagtacgaatacctgccgctggtggcgatccaggagaac
agcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccg
gtggaagtctcggtgctggaccgcgcgcaaagcctgaacgccacctcggattccggccgc
acccacaccaacttcccgctgaccgcggtgtgctacccgggggatgacctgggactgcac
ctgtcctacgaccagcgctacttcgagcaagcgaccatcgagcgcatgctcggcgaattc
aagcgcctgctgctggcgctggtgcagggcttccatggcgacatggccgagctgccgctg
ctgggcgcagaagaacaggacttcctgctcgccggctgcaaccagagcgagcatgactac
ccgctggagcgcagctacgtcgaactgttcgaggcccaggtggcggcccatccgcaacgc
atcgccgccagttgccaggagctgcaatacagctacaccgaactgaaccagcgcagtaac
cgcctgggccacgccctgatcgccaacggcgtgggcctggaccagccggtggccctgttg
gccgagcgcagcctggacctgctgggcatgatcatcggcagcttcaaggccggcgccggc
tacctgccgctggacccaggcctgccgagccagcgcctggggcggatcatcgagctgagc
cgcacgccgttgctggtgtgcaccgcggcctgccaggcacaggcgcaagccttgctcgac
gaattcgcctgcgccaaccgaccccgtttgttggtctgggaagaggtgcaagcggccgat
cattcgctggacaacccaggcatttacagcggcccggacaacctggcctatgtgatctac
acctcgggttccaccggcctgccgaagggcgtgatggtcgagcagcgcggcatgctcaac
aaccagctgagcaaggtgccgtacctgcaattgagcgaagccgacgtgatcgcccagacc
gcgtcgcagagcttcgacatttcggtctggcagttcctcgccgcgccgctgttcggcgcg
cgggtggacatcgtgccgaacgccatcgcccatgacccgcaaggtttgctggcccatgtg
caggcgcagcgcatcacggtgctggaaagcgtgccgtcgctgatccagggcatgctcgcc
caggagtccatccaccttgatggcctgcgctggatgctgccgaccggcgaggcgatgccg
ccggagctggcgcaccaatggctgttgcgttatccacagatcggcctggtcaatgcctac
ggtccggccgagtgctcggatgacgtggccttctaccgcgtcgatatggcctcgacccgt
ggcagctacttgccgatcggtacgccgaccgacaacaaccgcctgtacctgatggatggc
gcgctggatctggtgccgctgggcgcggtgggcgagctgtgcgtcgccggtaccggggtc
ggccgtggttacgtcagcgatccgctgcgcaccgcgcaggtgttcgtgccccatccgttc
ggtgccccgggcgaacgcctgtaccgcaccggcgacctggcacgccgtcgcgccgatggc
gtgctggaatacgtcgggcgcatcgaccaccaggtgaagatccgtggctaccgcatcgag
ctgggggaaatcgaagcccgcctgcacgaacaaccggaagtccgcgacgcggcggtcggc
gtgcaggaaggcgtcaacggcaagcatctggtgggctatctggtggccagcgactcggcg
ctgaacccgacggaacgcctggagcgcatcaagcagcgcctgcgcgccgagctgccggaa
tacatggtgccgctgcactggttgtggctggaacgcctgccgctcaacgccaacggcaag
ctcgaccgcaaggccctgccggccctggagatcggccagctgcacagccaggactacctg
gcgccgcgcagcgagctggagcagaccctggccgctatctgggccgaggtgctcaaggtc
gagcgggtcggggtccgggacaacttcttcgaactgggcgggcattcgctgctggccacg
cagatcgcctcgcgggtgcagaaaaccctgcaacgcaacgtgccgctgcgggcgatgttc
gagtgcagcacggtggaggaactggcgcagtacatcgacagcctggcgagcagtgaaatc
agcgaggagaaggtcgatcgcctgagcgatctgatggcggagctggaggggctgtaa

DBGET integrated database retrieval system